BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31289 (616 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC115737-1|AAI15738.1| 1272|Homo sapiens UPF2 regulator of nonse... 33 0.80 BC114964-1|AAI14965.1| 1272|Homo sapiens UPF2 regulator of nonse... 33 0.80 AY013249-1|AAG48509.1| 1272|Homo sapiens hUPF2 protein. 33 0.80 AL645617-1|CAI16755.1| 1272|Homo sapiens UPF2 regulator of nonse... 33 0.80 AL138898-4|CAH73458.1| 1272|Homo sapiens UPF2 regulator of nonse... 33 0.80 AF318574-1|AAG60689.1| 1272|Homo sapiens UPF2 protein. 33 0.80 AF301013-1|AAG33225.1| 1272|Homo sapiens regulator of nonsense t... 33 0.80 AB037829-1|BAA92646.1| 1298|Homo sapiens KIAA1408 protein protein. 33 0.80 Z98946-1|CAB46379.1| 577|Homo sapiens moesin protein. 32 1.8 M69066-1|AAA36322.1| 577|Homo sapiens moesin B protein. 32 1.8 BC017293-1|AAH17293.1| 577|Homo sapiens moesin protein. 32 1.8 AF295356-1|AAK71522.1| 527|Homo sapiens moesin/anaplastic lymph... 32 1.8 >BC115737-1|AAI15738.1| 1272|Homo sapiens UPF2 regulator of nonsense transcripts homolog (yeast) protein. Length = 1272 Score = 33.1 bits (72), Expect = 0.80 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 E+K++RLE+ ++K++ + KD K +KK E + + ER K +EQ Sbjct: 54 EDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQ 108 >BC114964-1|AAI14965.1| 1272|Homo sapiens UPF2 regulator of nonsense transcripts homolog (yeast) protein. Length = 1272 Score = 33.1 bits (72), Expect = 0.80 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 E+K++RLE+ ++K++ + KD K +KK E + + ER K +EQ Sbjct: 54 EDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQ 108 >AY013249-1|AAG48509.1| 1272|Homo sapiens hUPF2 protein. Length = 1272 Score = 33.1 bits (72), Expect = 0.80 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 E+K++RLE+ ++K++ + KD K +KK E + + ER K +EQ Sbjct: 54 EDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQ 108 >AL645617-1|CAI16755.1| 1272|Homo sapiens UPF2 regulator of nonsense transcripts homolog (yeast) protein. Length = 1272 Score = 33.1 bits (72), Expect = 0.80 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 E+K++RLE+ ++K++ + KD K +KK E + + ER K +EQ Sbjct: 54 EDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQ 108 >AL138898-4|CAH73458.1| 1272|Homo sapiens UPF2 regulator of nonsense transcripts homolog (yeast) protein. Length = 1272 Score = 33.1 bits (72), Expect = 0.80 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 E+K++RLE+ ++K++ + KD K +KK E + + ER K +EQ Sbjct: 54 EDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQ 108 >AF318574-1|AAG60689.1| 1272|Homo sapiens UPF2 protein. Length = 1272 Score = 33.1 bits (72), Expect = 0.80 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 E+K++RLE+ ++K++ + KD K +KK E + + ER K +EQ Sbjct: 54 EDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQ 108 >AF301013-1|AAG33225.1| 1272|Homo sapiens regulator of nonsense transcripts 2 protein. Length = 1272 Score = 33.1 bits (72), Expect = 0.80 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 E+K++RLE+ ++K++ + KD K +KK E + + ER K +EQ Sbjct: 54 EDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQ 108 >AB037829-1|BAA92646.1| 1298|Homo sapiens KIAA1408 protein protein. Length = 1298 Score = 33.1 bits (72), Expect = 0.80 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +1 Query: 448 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 E+K++RLE+ ++K++ + KD K +KK E + + ER K +EQ Sbjct: 80 EDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQ 134 >Z98946-1|CAB46379.1| 577|Homo sapiens moesin protein. Length = 577 Score = 31.9 bits (69), Expect = 1.8 Identities = 14/57 (24%), Positives = 30/57 (52%) Frame = +1 Query: 442 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 + E+ + +EAE+ ++A+LQA +D KT ++ +S ++ R K + + Sbjct: 385 EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESE 441 >M69066-1|AAA36322.1| 577|Homo sapiens moesin B protein. Length = 577 Score = 31.9 bits (69), Expect = 1.8 Identities = 14/57 (24%), Positives = 30/57 (52%) Frame = +1 Query: 442 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 + E+ + +EAE+ ++A+LQA +D KT ++ +S ++ R K + + Sbjct: 385 EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESE 441 >BC017293-1|AAH17293.1| 577|Homo sapiens moesin protein. Length = 577 Score = 31.9 bits (69), Expect = 1.8 Identities = 14/57 (24%), Positives = 30/57 (52%) Frame = +1 Query: 442 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 + E+ + +EAE+ ++A+LQA +D KT ++ +S ++ R K + + Sbjct: 385 EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESE 441 >AF295356-1|AAK71522.1| 527|Homo sapiens moesin/anaplastic lymphoma kinase fusion protein protein. Length = 527 Score = 31.9 bits (69), Expect = 1.8 Identities = 14/57 (24%), Positives = 30/57 (52%) Frame = +1 Query: 442 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERTKTKEQ 612 + E+ + +EAE+ ++A+LQA +D KT ++ +S ++ R K + + Sbjct: 385 EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESE 441 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.316 0.129 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,445,543 Number of Sequences: 237096 Number of extensions: 1065473 Number of successful extensions: 7809 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 7560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7794 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6579110070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -