BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31288 (544 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13072-2|AAK31397.2| 380|Caenorhabditis elegans Hypothetical pr... 29 1.6 U28731-9|AAA68301.2| 437|Caenorhabditis elegans Hypothetical pr... 27 6.6 >U13072-2|AAK31397.2| 380|Caenorhabditis elegans Hypothetical protein C07D10.5 protein. Length = 380 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -3 Query: 119 LGRLLKQIPDFGIFRVSFSRQFLEAGTGLAFILLDV 12 LG LL D+ + +S +++LE GTG + I LD+ Sbjct: 278 LGTLLFLFLDYYLDVISLEKEYLEIGTGESLIKLDI 313 >U28731-9|AAA68301.2| 437|Caenorhabditis elegans Hypothetical protein F12A10.8 protein. Length = 437 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 295 SIFPRSPISRTWQVQIFGVYQD 230 S FPRS IS+TW GV +D Sbjct: 94 SNFPRSNISKTWDFSDIGVKKD 115 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,970,798 Number of Sequences: 27780 Number of extensions: 214296 Number of successful extensions: 597 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1091917214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -