BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31288 (544 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 23 1.5 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 23 1.5 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 4.6 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 6.1 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +2 Query: 179 NKYRPGANNTTGHRRQEVLINAKDLNLPGPAYGGSW 286 N Y NN + +IN + + +P P Y G++ Sbjct: 103 NNYNNNYNNNYKKLYKNYIINIEQIPVPVPVYYGNF 138 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +2 Query: 179 NKYRPGANNTTGHRRQEVLINAKDLNLPGPAYGGSW 286 N Y NN + +IN + + +P P Y G++ Sbjct: 103 NNYNNNYNNNYKKLYKNYIINIEQIPVPVPVYYGNF 138 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 4.6 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = -1 Query: 298 LSIFPRSPISRTWQVQIFGVYQDLLSSMTSGVISTRPVFVKFIHSIFTRLS 146 LS PI + G Y+ L M S I+ RP + I I T +S Sbjct: 265 LSAKGHRPIDDNIDDEFKGTYKTLYKQMWSQNITERPTTNEVITKIDTLIS 315 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = +3 Query: 444 LRQIYLLRQIIHL 482 L+QI++L Q+IHL Sbjct: 7 LQQIFILLQMIHL 19 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,534 Number of Sequences: 438 Number of extensions: 2631 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -