BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31287 (660 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 95 5e-22 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.48 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 25 0.85 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 25 0.85 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 25 0.85 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 3.4 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 22 4.5 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 4.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 7.9 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 7.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.9 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 7.9 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 95.1 bits (226), Expect = 5e-22 Identities = 44/90 (48%), Positives = 64/90 (71%) Frame = +1 Query: 256 EINPDGSYTYFYETNHGIAAQEQGVPRNLGGNPPAVPVVAQGSFSWTSPEGVPISVNYVA 435 E+N DG+Y +ET++GI+ QE G P+ + PVV+QGS S+T+P+G +S+ YVA Sbjct: 35 EVNFDGNYINNFETSNGISHQESGQPKQVDNE---TPVVSQGSDSYTAPDGQQVSITYVA 91 Query: 436 DENGYQPTGNAIPTSPPVPEQIARALAYIA 525 DENG+Q G+ IPT+PP+P +I RAL + A Sbjct: 92 DENGFQVQGSHIPTAPPIPPEIQRALEWNA 121 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.4 bits (53), Expect = 0.48 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 400 PEGVP-ISVNYVADENGYQPTGNAIPTSPPVPEQIARA 510 PE VP + ++ + G G+ TSPP P I+RA Sbjct: 1369 PERVPTVDLSPSPSDRGRNDDGSDRLTSPPTPLSISRA 1406 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 24.6 bits (51), Expect = 0.85 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 326 PCSWAAIPW 300 PC+WAA PW Sbjct: 300 PCTWAARPW 308 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 24.6 bits (51), Expect = 0.85 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 326 PCSWAAIPW 300 PC+WAA PW Sbjct: 300 PCTWAARPW 308 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 24.6 bits (51), Expect = 0.85 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 326 PCSWAAIPW 300 PC+WAA PW Sbjct: 300 PCTWAARPW 308 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 249 RK*NQPRRFLHLLLRNQPRYRCPRT 323 R+ PR L R+ PRY+ PRT Sbjct: 140 REPGTPRINFTKLKRHHPRYKRPRT 164 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 222 LRYLGYYSDGGNRGDRDG 169 LR+ G S GGN G R+G Sbjct: 139 LRHKGDGSPGGNGGPRNG 156 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 222 LRYLGYYSDGGNRGDRDG 169 LR+ G S GGN G R+G Sbjct: 139 LRHKGDGSPGGNGGPRNG 156 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +3 Query: 471 PHFPTSA*ADRSCSCLHRQEH 533 P PT D C+ LH H Sbjct: 455 PQLPTEESVDALCNTLHHWHH 475 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 85 ENEFYKKNPYRY 120 +NE Y K+PY Y Sbjct: 19 KNEMYPKDPYLY 30 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 85 ENEFYKKNPYRY 120 +NE Y K+PY Y Sbjct: 34 KNEMYPKDPYLY 45 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 395 VQENEPCATTGTAGGFPPRLRGTPCS 318 V ++E + T TAG FP + T S Sbjct: 714 VSKHEEVSRTSTAGQFPTNVATTVTS 739 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 235 ETVKFGNEINPDGSYTYFYET 297 E +KF N P G T F+E+ Sbjct: 236 EIIKFVNIFFPGGKKTTFFES 256 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,865 Number of Sequences: 438 Number of extensions: 4658 Number of successful extensions: 17 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -