BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31285 (336 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36414| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_49196| Best HMM Match : efhand (HMM E-Value=3.4e-39) 45 2e-05 SB_44952| Best HMM Match : efhand (HMM E-Value=3.4e-39) 45 2e-05 SB_7126| Best HMM Match : efhand (HMM E-Value=2e-26) 44 2e-05 SB_5690| Best HMM Match : efhand (HMM E-Value=7.39998e-41) 44 3e-05 SB_3425| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_644| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.005 SB_21204| Best HMM Match : efhand (HMM E-Value=1.7e-21) 36 0.011 SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0) 35 0.019 SB_47331| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.13 SB_16337| Best HMM Match : efhand (HMM E-Value=3.7e-16) 32 0.13 SB_45107| Best HMM Match : efhand (HMM E-Value=1.9e-07) 32 0.13 SB_48677| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.23 SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) 31 0.31 SB_13634| Best HMM Match : efhand (HMM E-Value=2e-24) 30 0.41 SB_18942| Best HMM Match : efhand (HMM E-Value=1.7e-30) 29 0.71 SB_22919| Best HMM Match : efhand (HMM E-Value=1.4e-09) 29 0.94 SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.6 SB_6352| Best HMM Match : GTP_CDC (HMM E-Value=1.49939e-42) 28 1.6 SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_3800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_28847| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.9 SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_57811| Best HMM Match : efhand (HMM E-Value=4.3e-05) 27 3.8 SB_30172| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21) 27 3.8 SB_866| Best HMM Match : efhand (HMM E-Value=7.4e-18) 27 3.8 SB_5197| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_1299| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_37456| Best HMM Match : DJ-1_PfpI (HMM E-Value=3) 27 5.0 SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29) 27 5.0 SB_10186| Best HMM Match : efhand (HMM E-Value=3e-14) 27 5.0 SB_8773| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_49674| Best HMM Match : efhand (HMM E-Value=2e-13) 26 6.6 SB_19512| Best HMM Match : Ank (HMM E-Value=4.3e-16) 26 6.6 SB_2585| Best HMM Match : COX7C (HMM E-Value=2.4) 26 6.6 SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) 26 6.6 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 26 6.6 SB_37032| Best HMM Match : efhand (HMM E-Value=4.7e-35) 26 8.7 SB_10944| Best HMM Match : efhand (HMM E-Value=7.4e-24) 26 8.7 >SB_36414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 45.6 bits (103), Expect = 1e-05 Identities = 20/54 (37%), Positives = 38/54 (70%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 ELQ +I+E D + +G I+F F + + +++ D+E +E++EAFR++D++GN Sbjct: 48 ELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGN 98 >SB_49196| Best HMM Match : efhand (HMM E-Value=3.4e-39) Length = 659 Score = 44.8 bits (101), Expect = 2e-05 Identities = 20/54 (37%), Positives = 37/54 (68%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 ELQ +I+E D + +G I+F F + + ++ D+E +E++EAFR++D++GN Sbjct: 37 ELQDMINEVDADGNGTIDFPEFLTMMARKMKNTDSE---EEIREAFRVFDKDGN 87 >SB_44952| Best HMM Match : efhand (HMM E-Value=3.4e-39) Length = 250 Score = 44.8 bits (101), Expect = 2e-05 Identities = 20/54 (37%), Positives = 37/54 (68%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 ELQ +I+E D + +G I+F F + + ++ D+E +E++EAFR++D++GN Sbjct: 37 ELQDMINEVDADGNGTIDFPEFLTMMARKMKNTDSE---EEIREAFRVFDKDGN 87 >SB_7126| Best HMM Match : efhand (HMM E-Value=2e-26) Length = 213 Score = 44.4 bits (100), Expect = 2e-05 Identities = 20/54 (37%), Positives = 38/54 (70%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 ELQ +I+E D + +G I+F F + + + E+D++ +E++EAFR++D++GN Sbjct: 12 ELQDMINEVDADGNGIIDFPEFLTMMAKKMGEQDSD---EEIREAFRVFDKDGN 62 >SB_5690| Best HMM Match : efhand (HMM E-Value=7.39998e-41) Length = 153 Score = 44.0 bits (99), Expect = 3e-05 Identities = 20/54 (37%), Positives = 35/54 (64%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 ELQ +I E D + +G+++F+ F + ++ DAE E++EAFR++DR G+ Sbjct: 37 ELQQMIQEVDADGNGEVDFEEFLAMMKKQMQHRDAE---AEMREAFRVFDRNGD 87 >SB_3425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 38.3 bits (85), Expect = 0.002 Identities = 16/50 (32%), Positives = 31/50 (62%) Frame = +2 Query: 185 LIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 +++ D G I+FD F ++ +F AE +++ L++AFR++DR G+ Sbjct: 183 ILNAFDKNGDGAIDFDEFVTMSRYF-RGRGAEKLEENLRQAFRVFDRNGD 231 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 67 LRKAFQMLDTTKSGYIDVLKISTILNTMG 153 LR+AF++ D GYI ++ + T+G Sbjct: 219 LRQAFRVFDRNGDGYISAEELRVAVTTLG 247 >SB_644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 36.7 bits (81), Expect = 0.005 Identities = 18/54 (33%), Positives = 32/54 (59%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 EL+A+I + D + SG I+ F + + + + E +L+EAF L+D++GN Sbjct: 52 ELKAMIKQADKDGSGDIDLPEFIELMASKSKNDTTE---SDLREAFSLFDKDGN 102 Score = 36.7 bits (81), Expect = 0.005 Identities = 18/54 (33%), Positives = 32/54 (59%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 EL+A+I + D + SG I+ F + + + + E +L+EAF L+D++GN Sbjct: 181 ELKAMIKQADKDGSGDIDLPEFIELMASKSKNDTTE---SDLREAFSLFDKDGN 231 >SB_21204| Best HMM Match : efhand (HMM E-Value=1.7e-21) Length = 202 Score = 35.5 bits (78), Expect = 0.011 Identities = 17/53 (32%), Positives = 32/53 (60%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREG 331 ELQ +I+ D + +G +NFD F + + + ++++ EAFR++DR+G Sbjct: 87 ELQDMINSVDCDGNGLMNFDEFVKL---MITKNQFMMDEEDMLEAFRMFDRDG 136 >SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0) Length = 1115 Score = 34.7 bits (76), Expect = 0.019 Identities = 16/46 (34%), Positives = 31/46 (67%) Frame = +2 Query: 185 LIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYD 322 ++ + D E++GKI+FD F + + ++ + D Q+E+ +AFRL+D Sbjct: 70 IMKDYDRESTGKISFDDFNEVMTDWMLDRDP---QEEVFKAFRLFD 112 >SB_47331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 31.9 bits (69), Expect = 0.13 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGF 238 EL+A+ END +NSGK++F F Sbjct: 433 ELKAIFAENDADNSGKVSFSAF 454 >SB_16337| Best HMM Match : efhand (HMM E-Value=3.7e-16) Length = 168 Score = 31.9 bits (69), Expect = 0.13 Identities = 10/41 (24%), Positives = 26/41 (63%) Frame = +1 Query: 46 DEQKMAMLRKAFQMLDTTKSGYIDVLKISTILNTMGQLFDD 168 ++ ++ ++AF M+D + G+ID + + +++G+L +D Sbjct: 25 EQSQIQEFKEAFNMIDQNRDGFIDKNDLKAVFDSLGKLVND 65 >SB_45107| Best HMM Match : efhand (HMM E-Value=1.9e-07) Length = 270 Score = 31.9 bits (69), Expect = 0.13 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFC 241 E+Q LID+ DP+ G+I F+ FC Sbjct: 74 EVQTLIDKLDPDGVGRITFEEFC 96 >SB_48677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 586 Score = 31.1 bits (67), Expect = 0.23 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNI 247 E+Q+++DE D + GK++++ FCN+ Sbjct: 180 EVQSILDEADYNHDGKLDYNEFCNM 204 >SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) Length = 354 Score = 30.7 bits (66), Expect = 0.31 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +2 Query: 200 DPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 D + +G I+F F + + L+ DA+P ++E FR++DR+ N Sbjct: 263 DSDGNGAIDFPEFLQLMTKNLQ--DADP-DDTMQETFRVFDRDNN 304 >SB_13634| Best HMM Match : efhand (HMM E-Value=2e-24) Length = 176 Score = 30.3 bits (65), Expect = 0.41 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +2 Query: 176 LQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 +Q +I D + +G+++F F S F + D E +LK AFR+YD + + Sbjct: 76 VQRVITIFDADGNGEVDFKEFIEGVSQFSVKGDKE---SKLKFAFRIYDMDND 125 >SB_18942| Best HMM Match : efhand (HMM E-Value=1.7e-30) Length = 233 Score = 29.5 bits (63), Expect = 0.71 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = +2 Query: 176 LQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDRE 328 + +I + D + SG+I FD F + ++ D + E+ + F+++D + Sbjct: 128 IAGMIADLDADQSGRIEFDEFLDFI--ISKQSDGRDVHDEIVQGFKMFDTD 176 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 52 QKMAMLRKAFQMLDTTKSGYIDVLKISTILNTMG 153 Q++ L+ F DT KSG ID ++ + T+G Sbjct: 87 QEIRDLKLVFDTFDTDKSGSIDGRELRKAMRTLG 120 >SB_22919| Best HMM Match : efhand (HMM E-Value=1.4e-09) Length = 117 Score = 29.1 bits (62), Expect = 0.94 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = +2 Query: 161 SMTHELQALIDENDPENSGKINFDGFCN 244 ++ +++A+I+ DP + GKI+F+ C+ Sbjct: 36 ALKQQVRAMIEAADPNSDGKISFEDICS 63 >SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 28.3 bits (60), Expect = 1.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 182 LEVRESSNSCPIVLRMVEIFSTSM*PDFVVSNI 84 LE R S CP+ LR V +F S +F++S++ Sbjct: 76 LEARPSMMYCPLTLRWVILFKMSGGNNFIISSM 108 >SB_6352| Best HMM Match : GTP_CDC (HMM E-Value=1.49939e-42) Length = 275 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 67 LRKAFQMLDTTKSGYIDVLKISTI 138 L K F+ D ++GY+DV IST+ Sbjct: 12 LSKVFKFADVEETGYVDVATISTL 35 >SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 27.9 bits (59), Expect = 2.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 185 LIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQ 292 L ND N +I G C+I H ++ DA P++Q Sbjct: 217 LSQHNDDLNFQEIEQLGRCSIIEHIIDTGDASPIRQ 252 >SB_3800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 2.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 67 LRKAFQMLDTTKSGYIDVLKISTILNTMGQLF 162 L KAF++LD K GY+ +++ + G+ F Sbjct: 64 LSKAFEVLDQDKKGYLTTEELTKYMTEEGEAF 95 >SB_28847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.5 bits (58), Expect = 2.9 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 37 YSDDEQKMAMLRKAFQMLDTTKSGYIDVLKISTILNTMGQ 156 Y D + + +K F D SG ID++++ ++ +GQ Sbjct: 35 YPDLKGTLDAYKKQFMEYDVNNSGDIDIMELKMMMEKLGQ 74 >SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 27.1 bits (57), Expect = 3.8 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRL 316 E + L+ DP +GK+ F F + + E D++ +Q + E+FR+ Sbjct: 559 EFERLLGIVDPNGTGKVTFQAFVDFMTR--ETADSDTAEQ-VMESFRI 603 >SB_57811| Best HMM Match : efhand (HMM E-Value=4.3e-05) Length = 70 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 67 LRKAFQMLDTTKSGYIDVLKISTILNTMGQLFDD 168 LRKAF+ LD GY+ + + ++L + ++ Sbjct: 8 LRKAFRKLDLQNDGYLSIPEFRSVLRLCNTVLEE 41 >SB_30172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 701 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 67 LRKAFQMLDTTKSGYIDVLKISTILNTMGQLFDD 168 LRKAF+ LD GY+ + + ++L + ++ Sbjct: 639 LRKAFRKLDLQNDGYLSIPEFRSVLRLCNTVLEE 672 >SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21) Length = 172 Score = 27.1 bits (57), Expect = 3.8 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 25 RATWYSDDEQKMAMLRKAFQMLDTTKSGYIDVLKISTILN 144 RA S + ++ ++ KAF +DTT G I + + + N Sbjct: 98 RAVRPSMSKNRVEIIMKAFHKMDTTGDGVITIADLKKVYN 137 >SB_866| Best HMM Match : efhand (HMM E-Value=7.4e-18) Length = 171 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +1 Query: 46 DEQKMAMLRKAFQMLDTTKSGYIDVLKISTILNTMGQ 156 D+ ++ ++AF M+D G+ID + +L ++G+ Sbjct: 26 DQSQIQEFKEAFNMIDQNHDGFIDKEDLHDMLASLGK 62 >SB_5197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 26.6 bits (56), Expect = 5.0 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = +3 Query: 114 RRAEDLHHSQHNGTAVR*LTNFKHSSMKTIRKTAGRSTSMASVILLPISLKRKTLNPCNK 293 ++ ED+ HS + R TN +SM T KT S+ +L + + +T N Sbjct: 1442 KQGEDIDHSSADHVKSRDTTNLTVNSMSTDNKTQEVKNKYHSLPILEGNNEAQTYNVLTS 1501 Query: 294 N 296 N Sbjct: 1502 N 1502 >SB_1299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 26.6 bits (56), Expect = 5.0 Identities = 13/54 (24%), Positives = 30/54 (55%) Frame = +2 Query: 167 THELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDRE 328 ++E+Q L+++++ + S + D F IAS +D + +++ F+ +D E Sbjct: 47 SYEVQELMNKSNDDTSSGMTIDTFLRIASTKTLAQDPD---DHIRQVFQAFDME 97 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 49 EQKMAMLRKAFQMLDTTKSGYID 117 EQK +L+ AFQ+ D T GY+D Sbjct: 8 EQKTNILQ-AFQLADKTSKGYLD 29 >SB_37456| Best HMM Match : DJ-1_PfpI (HMM E-Value=3) Length = 232 Score = 26.6 bits (56), Expect = 5.0 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +3 Query: 123 EDLHHSQHNGTAVR*LTNFKHSSMKTIRKTAGRSTSMASVILLPISLKRK 272 E L S H R L + KH+S + ++K R+ V++L ++ RK Sbjct: 118 EGLAPSNHKEADTRILLHVKHASARGMKKVLIRTVD-TDVVILAVAFARK 166 >SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29) Length = 420 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 260 LEEEDAEPMQQELKEAFRLYDREG 331 + E+ +E ELKEAF L+D++G Sbjct: 280 VREKLSEEQVAELKEAFALFDKDG 303 >SB_10186| Best HMM Match : efhand (HMM E-Value=3e-14) Length = 133 Score = 26.6 bits (56), Expect = 5.0 Identities = 10/41 (24%), Positives = 24/41 (58%) Frame = +1 Query: 46 DEQKMAMLRKAFQMLDTTKSGYIDVLKISTILNTMGQLFDD 168 D+ ++ ++AF M+D + G+ID + + ++G+ +D Sbjct: 26 DQTQIQEFKEAFNMIDQNRDGFIDKEDLKDMYASLGKSPND 66 >SB_8773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 26.6 bits (56), Expect = 5.0 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +3 Query: 123 EDLHHSQHNGTAVR*LTNFKHSSMKTIRKTAGRSTSMASVILLPISLKRK 272 E L S H R L + KH+S + ++K R+ V++L ++ RK Sbjct: 310 EGLAPSNHKEADTRILLHVKHASARGMKKVLIRTVD-TDVVILAVAFARK 358 >SB_49674| Best HMM Match : efhand (HMM E-Value=2e-13) Length = 105 Score = 26.2 bits (55), Expect = 6.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 73 KAFQMLDTTKSGYIDVLKISTIL 141 K F+ DT KSGYI+V ++ L Sbjct: 28 KIFKKYDTDKSGYIEVPELKVFL 50 >SB_19512| Best HMM Match : Ank (HMM E-Value=4.3e-16) Length = 142 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 165 IEQLSHCVENGGDLQHVDVTRLRGVQHLECFTQHGHL 55 +E L +E+GGD+ D+T G L +++GHL Sbjct: 57 LEALKLLLEHGGDINQCDIT---GSSPLHVSSRNGHL 90 >SB_2585| Best HMM Match : COX7C (HMM E-Value=2.4) Length = 193 Score = 26.2 bits (55), Expect = 6.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 79 FQMLDTTKSGYIDVLKISTILNTMGQ 156 F DT SG ID++K+ ++ +GQ Sbjct: 3 FMEYDTDCSGEIDIVKLKLVMEKLGQ 28 >SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) Length = 2748 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 232 IEVDLPA-VFRIVFIDECLKFVSHRTAVPLC 143 +++ LP+ F VFIDE + + T +PLC Sbjct: 501 VKMGLPSGYFSHVFIDEAAQAMEAETLIPLC 531 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 26.2 bits (55), Expect = 6.6 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = +2 Query: 173 ELQALIDENDPENSGKINFDGFCNIASHFLEEEDAEPMQQELKEAFRLYDREGN 334 +L++L DE E + + +G N+A + E+ E ++K+A L + EGN Sbjct: 2414 KLESLKDEYSGEKTKLVEAEG--NLARVQRDLEEKEKKLNDIKQASDLSENEGN 2465 >SB_37032| Best HMM Match : efhand (HMM E-Value=4.7e-35) Length = 552 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 67 LRKAFQMLDTTKSGYIDVLKISTILNTMGQLFDD 168 LRKAF+ +D + G+I+ ++ +L D+ Sbjct: 18 LRKAFEAVDVNRDGFINRAELQKVLFDFHYFLDE 51 >SB_10944| Best HMM Match : efhand (HMM E-Value=7.4e-24) Length = 127 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 269 EDAEPMQQELKEAFRLYDREGN 334 E E +QE++EAF L+D +G+ Sbjct: 22 ELTEEQKQEIREAFDLFDTDGS 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,073,162 Number of Sequences: 59808 Number of extensions: 221974 Number of successful extensions: 1432 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1426 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 473307974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -