BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31285 (336 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 0.58 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 3.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 22 7.1 AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 22 7.1 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 21 9.4 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 25.4 bits (53), Expect = 0.58 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 66 AA*SIPDVGHHEVWLHRRAEDLH 134 AA + P + VW HR DLH Sbjct: 889 AAAAAPTASRYAVWAHRMIPDLH 911 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 230 DGFCNIASHFLEEEDAEPMQQELKEAFRLYDR 325 DG IA H +EE++ ++++ K + DR Sbjct: 627 DGVTYIADHTRKEEESSRVKEDWKYVAMVLDR 658 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -3 Query: 265 FKEMGSNITEAIEVDLPAVFRIVFIDECL 179 F SN T A + +F ++F EC+ Sbjct: 136 FPNSDSNSTNAALEKIEYIFLVIFTAECI 164 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 293 LVAWVQRLPLQGNGKQYY 240 L+ W L + NGK+YY Sbjct: 151 LMKWNGALEKRANGKEYY 168 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 21.4 bits (43), Expect = 9.4 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -3 Query: 61 PSFVHHRNTMLHVKDWR 11 P FV +T++H+ +W+ Sbjct: 26 PHFVRGHSTIVHLFEWK 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 373,569 Number of Sequences: 2352 Number of extensions: 6923 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 23774685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -