BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31283 (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1048 + 10770461-10770612,10770721-10770730,10771457-107716... 27 6.3 01_06_0639 + 30772804-30772904,30773386-30775675 27 6.3 05_06_0002 - 24788373-24788466,24788540-24788787 27 8.4 >12_01_1048 + 10770461-10770612,10770721-10770730,10771457-10771624, 10771668-10772017,10772107-10772508,10772940-10773318, 10773801-10774046 Length = 568 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 350 GNVRCRRLESTLVSDVGHSVSNTVRADVRKFSAN 249 G CRR +S ++ GHS++ T V F +N Sbjct: 174 GEACCRREKSQAIAGPGHSIAVTTSGAVYTFGSN 207 >01_06_0639 + 30772804-30772904,30773386-30775675 Length = 796 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +3 Query: 126 RQDNDNIGVEGYNTGYETSNGIKAQETGQLKNIGTENEALEVRGEFAYIGPDGVTY 293 R+ +N GV GY TG+ +G +G N +A + R ++ Y GP G +Y Sbjct: 221 RRQGNNSGVSGYGTGHH-YHGSDTYRSGY--NTQNNQQAYDSR-QYGY-GPSGQSY 271 >05_06_0002 - 24788373-24788466,24788540-24788787 Length = 113 Score = 27.1 bits (57), Expect = 8.4 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 499 FFFFFFYLNVCIII 458 FFFFFF+ VC+++ Sbjct: 10 FFFFFFFFCVCVLV 23 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,185,591 Number of Sequences: 37544 Number of extensions: 169616 Number of successful extensions: 445 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -