BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31282 (622 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 99 5e-36 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 31 1.00 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 25 1.7 SB_605| Best HMM Match : Calx-beta (HMM E-Value=0) 29 3.0 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 28 5.3 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 28 7.0 SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 28 7.0 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_2412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 98.7 bits (235), Expect(2) = 5e-36 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +2 Query: 116 TTMGDIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 295 T ++ DT F +G+SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 585 TMAEELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 70.5 bits (165), Expect(2) = 5e-36 Identities = 29/62 (46%), Positives = 44/62 (70%) Frame = +2 Query: 395 QLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKELLCTVLKSCGEECVIA 574 ++T+I +DGYL LM DNGD R D+K+ D D+ ++R F++ + + TVLK+ GEE V+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVG 702 Query: 575 VK 580 VK Sbjct: 703 VK 704 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 30.7 bits (66), Expect = 1.00 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 129 TSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVH-ARLLKCPH 263 T+K HT++P T P P N+ P + + +L ++H + PH Sbjct: 168 TTKPHTTKPHTTKPHTTKPHNIDPTLPSPTLLNALLHFLYFYQAPH 213 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 105 KFKTQQWVTSKTHTSRPETPGPQPPSPCNVRPC 203 K KT + T+K +T++P T P+ P +PC Sbjct: 100 KPKTTKPHTNKPYTTKPRTTKPRTTKPHTTKPC 132 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 129 TSKTHTSRPETPGPQPPSPCNVRP 200 T+K HT++P T PQ P +P Sbjct: 68 TTKPHTTKPRTTKPQTTKPHTTKP 91 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 114 TQQWVTSKTHTSRPETPGPQPPSPCNVRP 200 T + T+K T++P T P PC +P Sbjct: 108 TNKPYTTKPRTTKPRTTKPHTTKPCTTKP 136 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.00 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +3 Query: 117 QQWVTSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVHARLLKCPHPKP 272 +Q V S P P P PP+PC + PC +T +VVH+ L P P Sbjct: 126 EQHVVSHVMHPAPPPPPPPPPAPC-MPPCHQT-----QVVHSVQLHASPPGP 171 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 24.6 bits (51), Expect(2) = 1.7 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 180 SPCNVRPCVKTVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLISSMVKSMK 338 +PC ++ C + +S+ V ++K P P TL ++G + +K +K Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIGHQARKLKIVK 450 Score = 23.8 bits (49), Expect(2) = 1.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 162 PGPQPPSPCNVRP 200 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 >SB_605| Best HMM Match : Calx-beta (HMM E-Value=0) Length = 1958 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 151 LEVCVFDVTHCCVLNLTTVRNDKIKKITIY 62 + + +F VT+CC L LT + + +++TIY Sbjct: 14 VNLIIFTVTNCCFLVLTALIGFRDRQVTIY 43 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 206 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVGIDIFNG 325 + G +M +G+PCKI + K G HG +H+ G D NG Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG-DNTNG 55 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +2 Query: 320 NGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNG 448 NG Y CP N D + EDY + D YLT D G Sbjct: 400 NGHTYHMTCPGQTNFDPAKKRCEDYDCSG-RDVAYLTDQNDGG 441 >SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 28.7 bits (61), Expect = 4.0 Identities = 21/84 (25%), Positives = 37/84 (44%) Frame = +2 Query: 347 PSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKE 526 P + + V + +++ D + ADN + RE+ + +L ++ T G Sbjct: 284 PESDGIRVDETENGEHEAVDELPEDKPDTEADNYEQREETPTKEDELKSECTTSDSEGTP 343 Query: 527 LLCTVLKSCGEECVIAVKANTALD 598 T KS GEE V A ++ +LD Sbjct: 344 SAATYGKSDGEENV-AQESEESLD 366 >SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 28.7 bits (61), Expect = 4.0 Identities = 30/131 (22%), Positives = 53/131 (40%), Gaps = 8/131 (6%) Frame = +2 Query: 140 THFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKT-----GKHGHAKVHLV 304 T E+G + P QC+ + F+ RP + + S ++ G + L Sbjct: 865 TRRESGQRVSHGLSPKQCAVSVVSSFMDSGARPRRFLPGSQARPRRFLPGSQPRPRRFLP 924 Query: 305 GIDIFNGKKYE--DICPSTHNMDVPHVKREDYQLTDISD-DGYLTLMADNGDLREDLKIP 475 + + G Y ++ P +D+ + Y++ ++ D YL L D GD LK+ Sbjct: 925 VLKLDPGDFYRVLNLDPGDFYLDLKLDPGDFYRVLNLDPGDFYLDLKLDPGDFYPVLKLD 984 Query: 476 DGDLGTQLRTD 508 GD L+ D Sbjct: 985 PGDFYPVLKRD 995 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -2 Query: 555 PQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRSPLSAIRVR 424 P+ S V + +LP+ V C+P SPS I RS P VR Sbjct: 253 PRQISNVRSLTLPVRYQVIGCLP-SPSDIKRSVPYPPRQISNVR 295 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 27.9 bits (59), Expect = 7.0 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 132 SKTHTSRPETPGPQPPSPCNV 194 ++T T++PET P+PP+P + Sbjct: 165 TETTTTKPETKPPKPPAPSTI 185 >SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 27.9 bits (59), Expect = 7.0 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Frame = +2 Query: 362 MDVPHVKREDYQLTDISDDGYLT----LMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 529 +D+P+ K + + L ++DD L+ + D L E L PD + R D G E Sbjct: 37 LDIPYEKYDKFDLESLTDDECLSEFRFIKNDLYRLNEALNFPD-QITCPNRLTVD-GMEA 94 Query: 530 LCTVLKSCGEEC 565 LC L+ C Sbjct: 95 LCMTLRRFAYPC 106 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 126 VTSKTHTSRPETPGPQPPSPCNVRP 200 VT K T +P TP P P P RP Sbjct: 768 VTPKPVTPKPVTPKPVTPKPVTTRP 792 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 27.5 bits (58), Expect = 9.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 132 SKTHTSRPETPGPQPPSP 185 ++T T +P TP P PP+P Sbjct: 288 TRTPTPKPRTPTPSPPTP 305 >SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1005 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 147 SRPETPGPQPPSPCNVRP 200 +RP TPG +PP P N P Sbjct: 166 TRPTTPGMRPPEPINDAP 183 >SB_2412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 589 Score = 27.5 bits (58), Expect = 9.3 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 114 TQQWVTSKTHTSRPETPGPQPP-SPCNVRPCVKTVSL 221 T + +K HTS TPG P SP + P T SL Sbjct: 262 TPEMAVNKRHTSVSHTPGGVVPFSPASFSPAAATPSL 298 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,225,114 Number of Sequences: 59808 Number of extensions: 454475 Number of successful extensions: 1476 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1461 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -