BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31279 (424 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces po... 25 6.4 SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces ... 24 8.5 >SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 24.6 bits (51), Expect = 6.4 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 416 SFNSFNLIVFILFYLSTGLTVFYTFRLIIYVIINDFNLI 300 S + + +V IL+YL L VF++ + V+I D N + Sbjct: 236 SLSIWQSLVMILYYLLYVLFVFFSGSSGVSVVITDENYL 274 >SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1429 Score = 24.2 bits (50), Expect = 8.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 347 TFRLIIYVIINDFNLIIIYNLYD 279 TF IYV+IN N + +LYD Sbjct: 533 TFDTTIYVVINSLNDPLKLSLYD 555 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 810,182 Number of Sequences: 5004 Number of extensions: 10815 Number of successful extensions: 39 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 150383836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -