BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31277 (669 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.091 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 31 0.85 SB_33200| Best HMM Match : Spc97_Spc98 (HMM E-Value=0.0037) 30 1.5 SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) 30 1.5 SB_41| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) 29 4.5 SB_59534| Best HMM Match : AA_permease (HMM E-Value=3.1e-05) 28 6.0 SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) 28 7.9 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 34.3 bits (75), Expect = 0.091 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +2 Query: 446 IEEKRQRLEEAEKKRQAMLQAMKDA 520 +EE+R+RLE EK+RQA QAM++A Sbjct: 319 LEEERKRLENLEKERQAAQQAMQEA 343 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 31.1 bits (67), Expect = 0.85 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +2 Query: 449 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIPKKSENFGFE 577 EE+RQ+ EEA K+R+ L A K++SK+ ++S N F+ Sbjct: 1344 EERRQKREEARKRREEKL-AKKESSKSSNKRKSKERSGNPSFK 1385 >SB_33200| Best HMM Match : Spc97_Spc98 (HMM E-Value=0.0037) Length = 1235 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 636 RFSSPLPAAPWSCCAPAGHCSKPKFSL 556 +F + L + PW P GH + P FSL Sbjct: 1174 KFRAQLNSCPWQQATPRGHVTHPSFSL 1200 >SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) Length = 1168 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/34 (35%), Positives = 25/34 (73%) Frame = +2 Query: 443 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFT 544 ++EEK++RL+ E+ + ++ +A K+ASK+ + T Sbjct: 427 EVEEKKRRLQRYERLQSSLNEAYKEASKSSVDGT 460 >SB_41| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 642 TGRFSSPLPAAPWSCCAPAGHCSKPKFS 559 TG++S P +CCA A C K F+ Sbjct: 193 TGQYSQTCTQGPGACCATAESCCKASFT 220 >SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 729 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 443 DIEEKRQRLEEAEKKRQAMLQAMKD 517 D+EEK + LEEA+ + +A+ MKD Sbjct: 522 DLEEKAKELEEAKSENEAISGKMKD 546 >SB_59534| Best HMM Match : AA_permease (HMM E-Value=3.1e-05) Length = 889 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +3 Query: 555 RAKTSVLSNAQLERNKTKEQLEEEKK 632 R K + + N Q+E NK + LEEEKK Sbjct: 269 RLKGAAVLNIQIEDNKQQRLLEEEKK 294 >SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +2 Query: 179 PAPKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQRA 298 PA ++EGEG+P+ +R+ Q + ++Q K + +K ++ Sbjct: 56 PANEEEGEGEPKPKRRKAQPSAPKEKQTKSRKRDKKKDKS 95 >SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) Length = 337 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 380 RGAFLLRHEKPCAWPASL*GV 318 RGA L R+E PC W A L G+ Sbjct: 69 RGAALQRNEPPCMWIAILNGI 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,016,275 Number of Sequences: 59808 Number of extensions: 235270 Number of successful extensions: 963 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -