BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31274 (336 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 23 0.86 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 20 6.0 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 23.0 bits (47), Expect = 0.86 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 146 TSGVVKKLSTLLDKVQCSSRRRVHIDNVTMEKQLYYQHF-LNQLILAI 6 ++ V +L L KV+ RV N + KQL Y+H+ L QL + I Sbjct: 113 STAFVFRLKQLNAKVEMLKNARVK--NTALWKQLRYEHYRLYQLSVLI 158 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 20.2 bits (40), Expect = 6.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 155 IAISSDDLRRQGRYHVLTTY 214 I++ DD + + HV TTY Sbjct: 329 ISVIQDDAQMRLNKHVTTTY 348 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,053 Number of Sequences: 336 Number of extensions: 1160 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6579502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -