BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31273 (344 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6B12.16 |meu26||conserved fungal protein|Schizosaccharomyces... 29 0.27 SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|... 26 1.9 SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|... 25 3.3 >SPAC6B12.16 |meu26||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 344 Score = 28.7 bits (61), Expect = 0.27 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +1 Query: 178 WVKCIWRRKLSFRMLSSWYWRNLRRC 255 W++C R+ +S ++ ++WR+ RC Sbjct: 311 WIRCQGRKDVSVKIPEIFWWRHAHRC 336 >SPBC25B2.11 |pof2||F-box protein Pof2|Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 25.8 bits (54), Expect = 1.9 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 181 VKCIWRRKLSFRMLSSWYWRNLRRCTSSIC 270 VKCI LS +LS + RNL R S C Sbjct: 362 VKCICLTDLSVILLSGSFSRNLERVHLSYC 391 >SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1234 Score = 25.0 bits (52), Expect = 3.3 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +2 Query: 86 QVIFNPVSINQFVLDNAVI 142 + + PV ++++VLDNA+I Sbjct: 1028 ETVEGPVKLSEYVLDNAII 1046 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,356,391 Number of Sequences: 5004 Number of extensions: 24719 Number of successful extensions: 55 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 102111100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -