BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31273 (344 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1564 - 38276207-38276434,38276571-38276707,38277214-382776... 27 5.2 12_02_0502 - 19746100-19746185,19746745-19750474 26 6.9 >01_06_1564 - 38276207-38276434,38276571-38276707,38277214-38277621, 38277895-38278256,38278427-38278524,38278727-38278863, 38279346-38279444,38279753-38280053 Length = 589 Score = 26.6 bits (56), Expect = 5.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 266 YANERRRELNKLDRTGTSVTIKILP 340 Y N+ R ++ +L + G +VT+K+ P Sbjct: 164 YQNKLRHDVEELSKVGINVTLKVSP 188 >12_02_0502 - 19746100-19746185,19746745-19750474 Length = 1271 Score = 26.2 bits (55), Expect = 6.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -1 Query: 314 CRSGRAYSTLSVAHLHIELVHRLRLRQYQDDNIRKLNFLRQMH 186 C S L + HL + + +Q D IR + FLR +H Sbjct: 655 CDKSHIRSILKLCHLQVFKLKYFTGKQADLDGIRNMRFLRCLH 697 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,581,616 Number of Sequences: 37544 Number of extensions: 152950 Number of successful extensions: 334 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 334 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 494158076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -