BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31269 (480 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 24 2.4 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 3.1 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 22 9.5 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 22 9.5 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 22 9.5 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 24.2 bits (50), Expect = 2.4 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -1 Query: 411 TSTPGSMLIEVICFTISEGECRSITLLWIR 322 +S+P + +C+ +SE E I +L+ R Sbjct: 79 SSSPRTRQFRSVCYYVSESEMEKIEMLFAR 108 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.8 bits (49), Expect = 3.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 305 RSLNLHRKEFSGW*YARSWLACGLGPL 225 RSLN+ R F G ++ W + PL Sbjct: 659 RSLNIRRGIFQGDTFSTLWFCLAMNPL 685 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 22.2 bits (45), Expect = 9.5 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 100 ETPGRGLPYSPHQDHSYFSQCTLTR 174 E PG +P PH SY S + + Sbjct: 360 EMPGMSVPPQPHTHPSYGSPAEIPK 384 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.2 bits (45), Expect = 9.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 374 QITSINIEPGVEVEVTIAD 430 Q+ S+N PG E +TIA+ Sbjct: 722 QLNSLNRGPGAENVITIAE 740 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 22.2 bits (45), Expect = 9.5 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +3 Query: 42 SAGIQQATWQPL*CQAKTSRNPRQRSPLFTASGSLLLLAM 161 S + +W +K R PR+R P F +S ++L + Sbjct: 280 SRSTRPTSWPRSRPTSKPKRLPRRRRPFFFSSWWCIILVL 319 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 515,263 Number of Sequences: 2352 Number of extensions: 11353 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 41863041 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -