BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31267 (827 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_37744| Best HMM Match : BON (HMM E-Value=9.7) 29 3.5 SB_54415| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) 29 3.5 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_14947| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) 29 3.5 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 29 3.5 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 28 8.0 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 694 PSNKPVSYNIIMTKGAWEYIKSLQFGRLQIV 786 PSNK VSY + M G +I+ + G+ QIV Sbjct: 846 PSNKQVSYTMTMNGGLLWFIEKPKVGKWQIV 876 >SB_37744| Best HMM Match : BON (HMM E-Value=9.7) Length = 116 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 694 PSNKPVSYNIIMTKGAWEYIKSLQFGRLQIV 786 PSNK VSY + M G +I+ + G+ QIV Sbjct: 75 PSNKQVSYTMTMNGGLLWFIEKPKVGKWQIV 105 >SB_54415| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) Length = 612 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 694 PSNKPVSYNIIMTKGAWEYIKSLQFGRLQIV 786 PSNK VSY + M G +I+ + G+ QIV Sbjct: 537 PSNKQVSYTMTMNGGLLWFIEKPKVGKWQIV 567 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 85 SSLVPNXLQPGGATSIERPPPR 20 S L P L+PG +ERPPPR Sbjct: 187 SYLAPEVLRPGDPLVLERPPPR 208 >SB_14947| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) Length = 666 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 694 PSNKPVSYNIIMTKGAWEYIKSLQFGRLQIV 786 PSNK VSY + M G +I+ + G+ QIV Sbjct: 493 PSNKQVSYTMTMNGGLLWFIEKPKVGKWQIV 523 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 103 LKKLETSSLVPNXLQPGGATSIERPPPR 20 +K ++ SL N PG +ERPPPR Sbjct: 7 VKWIDLKSLTSNSCSPGDPLVLERPPPR 34 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 103 LKKLETSSLVPNXLQPGGATSIERPPPR 20 L+ + SL+ N PG +ERPPPR Sbjct: 26 LRSTVSISLISNSCSPGDPLVLERPPPR 53 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 82 SLVPNXLQPGGATSIERPPPR 20 SL+ N PG +ERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 100 KKLETSSLVPNXLQPGGATSIERPPPR 20 +K SS N PG +ERPPPR Sbjct: 58 RKRRKSSTTSNSCSPGDPLVLERPPPR 84 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 82 SLVPNXLQPGGATSIERPPPR 20 SL+ N PG +ERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 100 KKLETSSLVPNXLQPGGATSIERPPPR 20 K +++SS N PG +ERPPPR Sbjct: 44 KIVKSSSRASNSCSPGDPLVLERPPPR 70 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 82 SLVPNXLQPGGATSIERPPPR 20 SL+ N PG +ERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 82 SLVPNXLQPGGATSIERPPPR 20 SL+ N PG +ERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 82 SLVPNXLQPGGATSIERPPPR 20 SL+ N PG +ERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 82 SLVPNXLQPGGATSIERPPPR 20 SL+ N PG +ERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 82 SLVPNXLQPGGATSIERPPPR 20 SL+ N PG +ERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 82 SLVPNXLQPGGATSIERPPPR 20 SL+ N PG +ERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 82 SLVPNXLQPGGATSIERPPPR 20 SL+ N PG +ERPPPR Sbjct: 30 SLISNSCSPGDPLVLERPPPR 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,972,552 Number of Sequences: 59808 Number of extensions: 393777 Number of successful extensions: 3124 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2329 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -