BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31266 (747 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.0 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 22 5.3 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 9.3 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 384 LRVAPEEHPVLLTEAPLNPKANREKM 461 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 146 GMCKAGFAGDDASR 187 GMCK G +GD ++ Sbjct: 130 GMCKEGISGDKTTK 143 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 587 VGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 495 VGD +A ++ D G + E+G G G Sbjct: 42 VGDDIAWMKFDKEGRLRAINPEYGFFGVAPG 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,469 Number of Sequences: 438 Number of extensions: 5676 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -