BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31263 (590 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 26 3.6 SPAC4H3.01 |||DNAJ domain protein Caj1/Djp1 type|Schizosaccharom... 25 6.2 SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|c... 25 8.3 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 26.2 bits (55), Expect = 3.6 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 575 ASITTVVNIGVQIKHLIHSIFKKVYLKTNHKKINRNLK 462 A+ T N+G + + H + KKVY K + ++I NL+ Sbjct: 692 ANWTLPSNLGGKSVSIYHKVIKKVYGKEHAQQIIENLQ 729 >SPAC4H3.01 |||DNAJ domain protein Caj1/Djp1 type|Schizosaccharomyces pombe|chr 1|||Manual Length = 392 Score = 25.4 bits (53), Expect = 6.2 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 4 LDRYIMK-TTQVAQYALRLTYSQQANREKMMTRSALLLATIG 126 LD +I K TT+ ALR Y+Q+AN ++ + +L IG Sbjct: 188 LDDWIAKATTEEGLNALREKYTQEANTLRIESFGVEILHAIG 229 >SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 436 Score = 25.0 bits (52), Expect = 8.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 294 WMHSGVFFFQKTFCFCI 244 W+++ +FF + FCF I Sbjct: 345 WVYACIFFLTRVFCFLI 361 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,420,732 Number of Sequences: 5004 Number of extensions: 46843 Number of successful extensions: 100 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -