BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31262 (459 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q95ZG3 Cluster: Spindle pole body component 97; n=2; Di... 33 3.0 UniRef50_A2DQE5 Cluster: Putative uncharacterized protein; n=1; ... 33 3.9 >UniRef50_Q95ZG3 Cluster: Spindle pole body component 97; n=2; Dictyostelium discoideum|Rep: Spindle pole body component 97 - Dictyostelium discoideum (Slime mold) Length = 1177 Score = 33.1 bits (72), Expect = 3.0 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +2 Query: 29 KNKNLIMECYRKVFDYLSCIVNYLLVS--HSIFELRALFNFDTLANTMGSAHTEETTY 196 KN+N+ ++ K +DY S I+ LL++ H I L+A+ ++ L +H +TTY Sbjct: 587 KNENVYIDKIEKAYDYASGILLNLLINERHLISRLKAIKHYFLLCKGDFFSHFMDTTY 644 >UniRef50_A2DQE5 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 791 Score = 32.7 bits (71), Expect = 3.9 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = -1 Query: 273 YFSQHLYYVAFLLGLGCKNEIHEFGMYVVSSVCADPIVFAKVS 145 ++ H Y + +L G +++ EF YVV+SVC P+V + +S Sbjct: 490 FYMNHTLYGSIVLCFGALSKVPEFHSYVVNSVC--PVVLSLLS 530 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 446,421,938 Number of Sequences: 1657284 Number of extensions: 8475837 Number of successful extensions: 19547 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19546 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 24351434270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -