BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31262 (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 25 0.96 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 2.2 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 2.9 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 22 9.0 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 22 9.0 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 25.4 bits (53), Expect = 0.96 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 300 NVHKLCAVMYVWAFQAYGVQSG 365 N+H LC + +W + +G+ SG Sbjct: 128 NIHNLCVLRVIW--RVFGISSG 147 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 2.2 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 163 NGIRAHRRNYIHSKFMNFIL 222 NGI A +R++I S F N+++ Sbjct: 1039 NGINAGKRSHILSLFANYVI 1058 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.8 bits (49), Expect = 2.9 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 456 YTILSNSFHVTLAFKNLILRSFHRLWTQQSRHSERHKPEM 337 Y + + F V++A+ L LRS H W + R KP + Sbjct: 6 YVLTAFVFVVSIAY--LYLRSRHNYWRDRCFPYTRQKPHL 43 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 22.2 bits (45), Expect = 9.0 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = -1 Query: 417 FKNLILRSFHRLWTQQSRHSERHKPEMP 334 F+ + S R+W Q H PE P Sbjct: 19 FRQAEIASLLRIWNIQMETPADHNPERP 46 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 22.2 bits (45), Expect = 9.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -2 Query: 410 ISYFGHFIDYGRNRAATL 357 +SY+ HF Y +N + L Sbjct: 2 VSYYNHFAMYPKNHSGNL 19 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,033 Number of Sequences: 2352 Number of extensions: 9764 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -