BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31256 (730 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37790| Best HMM Match : HAT (HMM E-Value=0.17) 31 0.96 >SB_37790| Best HMM Match : HAT (HMM E-Value=0.17) Length = 498 Score = 31.1 bits (67), Expect = 0.96 Identities = 21/65 (32%), Positives = 34/65 (52%) Frame = -3 Query: 449 KKKNLNNYIYYEQFVLTLQFELCFILIVYSLNSRHN*KLLLWVLDILFIINFIVS*LIEL 270 K K L NY +E + + FILI++ L S+ N +L L +LDI + I+ +E Sbjct: 307 KPKCLTNY--HENYKYARNLIIAFILIIHYLMSQDNKRLYLQLLDIRLNESPILEDKVEE 364 Query: 269 LFNCI 255 +F + Sbjct: 365 VFELV 369 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,252,688 Number of Sequences: 59808 Number of extensions: 313192 Number of successful extensions: 490 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -