BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31255 (762 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g05280.1 68417.m00799 Ulp1 protease family protein contains P... 28 5.9 At2g17600.1 68415.m02036 DC1 domain-containing protein contains ... 28 7.8 >At4g05280.1 68417.m00799 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At1g25886, At4g03300 Length = 1312 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +1 Query: 442 KLIKTFFFFCKHKWEAIIFC-SILFTGGHLCEHLKRYRPIAH*SNFGP 582 ++ K FFCK+ W + F S G L HL + I + GP Sbjct: 217 EMTKNLEFFCKYPWGRVSFTRSYALHGFSLALHLLAFETIPSIAKLGP 264 >At2g17600.1 68415.m02036 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 580 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -2 Query: 542 FKCSHRCPP--VNKIEQKIIASHLCL 471 +KC HRCP K+ +K+ S LC+ Sbjct: 541 YKCDHRCPDSVYYKLFEKVFCSWLCV 566 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,839,706 Number of Sequences: 28952 Number of extensions: 231508 Number of successful extensions: 362 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1702303248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -