BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31250 (357 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding pr... 25 1.1 AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 23 3.4 >AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding protein AgamOBP9 protein. Length = 139 Score = 24.6 bits (51), Expect = 1.1 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +2 Query: 233 DGVLLKTSVGRSVSDFNSIGMLCIGQNADGTKC 331 D ++++ + GR ++ + C G N DG C Sbjct: 82 DNLVVQLAHGRDANEVREEIVKCAGSNTDGNVC 114 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 23.0 bits (47), Expect = 3.4 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +1 Query: 160 LYHHHHVYEFGR*ITRPVQRLVHARRGTSKDQCRSVGLRFQ 282 LY + R + + + +H RG++ DQC V L ++ Sbjct: 220 LYTRDYEQPDERYLAQETEARLHKLRGSTGDQCTEVYLAYR 260 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 383,138 Number of Sequences: 2352 Number of extensions: 7338 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26224815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -