BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31249 (462 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 28 0.60 SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk... 26 3.2 SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 5.6 SPAC23H3.14 |||LAlv9 family protein|Schizosaccharomyces pombe|ch... 24 9.8 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 28.3 bits (60), Expect = 0.60 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +1 Query: 304 CLINFRW*F---LRLPWLPRVTGNQGSIPEREPEKRLP 408 C+IN W LRL +L + NQ S E++ EKR+P Sbjct: 271 CMINETWPVDRALRLQFLIQQRNNQSSNEEQKQEKRVP 308 >SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 3.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 417 PWMW*PFLRLPLRNRTLIPRYPWQPW*SQKLPS 319 P MW P N+ + YP +PW S+ LPS Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267 >SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 25.0 bits (52), Expect = 5.6 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 68 NGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSD 172 N IY+ +F ++S++ + + I L +RT++SD Sbjct: 14 NTQIYRIFFTLTFSLSNLFLAICYLFLNVRTVSSD 48 >SPAC23H3.14 |||LAlv9 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 469 Score = 24.2 bits (50), Expect = 9.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 301 HLKDASPVLDHAICKSYPDSSKLTTSDAR 215 HL+D S H++ KS + L TSD R Sbjct: 211 HLQDVSSPSAHSLEKSLHKPASLQTSDKR 239 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,982,445 Number of Sequences: 5004 Number of extensions: 38849 Number of successful extensions: 86 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 174340060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -