BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31249 (462 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-1481|AAN12009.1| 804|Drosophila melanogaster CG32353-P... 28 5.3 AE013599-527|AAF59178.2| 897|Drosophila melanogaster CG30377-PA... 27 9.3 >AE014296-1481|AAN12009.1| 804|Drosophila melanogaster CG32353-PA protein. Length = 804 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 255 VIQIHQN*RLRTRGPPSIGFDL 190 ++QI N + TR PPSIG DL Sbjct: 353 IVQIRDNIQAETRRPPSIGGDL 374 >AE013599-527|AAF59178.2| 897|Drosophila melanogaster CG30377-PA protein. Length = 897 Score = 27.5 bits (58), Expect = 9.3 Identities = 20/60 (33%), Positives = 26/60 (43%) Frame = -3 Query: 397 SQAPSPESNPDSPLPVATMVVAETTIES**GRHLKDASPVLDHAICKSYPDSSKLTTSDA 218 S PSP S P L +A TTI + R+L P+L A+ S P +T A Sbjct: 714 SATPSPASTPQLELEALHPGLATTTIVTQMQRNLTFHKPIL--AVSNSNPGGGNVTVDGA 771 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,021,743 Number of Sequences: 53049 Number of extensions: 450247 Number of successful extensions: 1259 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1258 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1539014778 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -