BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31249 (462 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 24 0.92 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.1 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.5 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.8 bits (49), Expect = 0.92 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 223 PKSLILMNLDNFCRSHGQVPAT 288 P+ L +NL + CR HG PAT Sbjct: 430 PRELEAVNLGSACRIHGS-PAT 450 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 2.1 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 32 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 166 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 20.6 bits (41), Expect = 8.5 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = -1 Query: 246 IHQN*RLRTRGPPSIGFDLIKALIPSLVRVLIACIS 139 I+Q L + +IG+ + + +PS++ V+++ +S Sbjct: 227 IYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVS 262 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,305 Number of Sequences: 438 Number of extensions: 2705 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12312900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -