BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31249 (462 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 0.66 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 2.0 At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase... 28 3.5 At1g72560.1 68414.m08391 tRNA export mediator exportin-t, putati... 27 6.2 At5g12460.1 68418.m01464 fringe-related protein similarity to pr... 27 8.2 At4g38560.1 68417.m05459 expressed protein 27 8.2 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 27 8.2 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 0.66 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 247 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 152 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 28.7 bits (61), Expect = 2.0 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -3 Query: 430 RLLPSLDVVAVSQAPSPESNPDSPLPVATMVVAE 329 RLLPSL VV+ +P+ + P S LP + + V E Sbjct: 84 RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117 >At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase C (PLC2) identical to phosphoinositide specific phospholipase C(AtPLC2) GI:857374 [Arabidopsis thaliana] Length = 581 Score = 27.9 bits (59), Expect = 3.5 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = -3 Query: 361 PLPVATMVVAETTIES**GRHLKDASPVLDHAICKSYPDSSKLTTSDARPSVDW 200 P V + ++E +E ++ K H + + YP +++T+S+ P V W Sbjct: 339 PDKVRRLSLSEEQLEKAAEKYAKQIVRFTQHNLLRIYPKGTRVTSSNYNPLVGW 392 >At1g72560.1 68414.m08391 tRNA export mediator exportin-t, putative (PAUSED) contains Pfam profile: PF04150 exportin-t, identical to PAUSED gi:30909318 Length = 988 Score = 27.1 bits (57), Expect = 6.2 Identities = 13/54 (24%), Positives = 29/54 (53%) Frame = -1 Query: 276 LTMRSAKVIQIHQN*RLRTRGPPSIGFDLIKALIPSLVRVLIACISSRITTVIQ 115 LT + +V++ H+ RL + ++ DL+ ++PS+ V+ C +++Q Sbjct: 304 LTGYAVEVLECHK--RLNSEDTKAVSMDLLNEVLPSVFYVMQKCEVDSTFSIVQ 355 >At5g12460.1 68418.m01464 fringe-related protein similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 415 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 350 GNHGSRRNYHRKLIRQTFERCVAGT*PCDLQKLS 249 GNH SR ++I T + V G CD+Q ++ Sbjct: 363 GNHSSRNITQVRVIATTMHKMVEGIECCDVQNVN 396 >At4g38560.1 68417.m05459 expressed protein Length = 521 Score = 26.6 bits (56), Expect = 8.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 56 GDTANGSIYQFWFLRSYSVTWITVVILEL 142 GD A+GS Q +SYS+ + V+LEL Sbjct: 360 GDIASGSKLQSLRTKSYSLETLAAVVLEL 388 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 26.6 bits (56), Expect = 8.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 421 PSLDVVAVSQAPSPESNPDSPLPVATMVVAETTIES 314 PS A + APSP +NP P V++ ES Sbjct: 39 PSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTES 74 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,563,322 Number of Sequences: 28952 Number of extensions: 214203 Number of successful extensions: 579 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 772134480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -