BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31248 (479 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 26 2.6 SPBC2D10.09 |||3-hydroxyisobutyryl-CoA hydrolase|Schizosaccharom... 26 2.6 SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pomb... 26 2.6 SPAP32A8.02 |||xylose and arabinose reductase |Schizosaccharomyc... 25 5.9 SPAC27E2.12 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 7.8 SPCC1919.03c |||AMP-activated protein kinase beta subunit |Schiz... 25 7.8 SPAC16E8.13 |||ubiquitin-protein ligase E3 |Schizosaccharomyces ... 25 7.8 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 26.2 bits (55), Expect = 2.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 131 VFVYPYEPTPKESEPFKSVGPDNKPFGYP 217 + VY + P +SE F +V DN YP Sbjct: 4194 ILVYQHLPDSSQSETFLNVVTDNSAVDYP 4222 >SPBC2D10.09 |||3-hydroxyisobutyryl-CoA hydrolase|Schizosaccharomyces pombe|chr 2|||Manual Length = 429 Score = 26.2 bits (55), Expect = 2.6 Identities = 11/58 (18%), Positives = 28/58 (48%) Frame = -2 Query: 286 VAQAFLEEHVRLFEVLRKNGAIEWITEWFVVRTNRLEWL*LLRCRFIRIDEYKQLEGE 113 +++AF +H+ + +L++ +E + + +T +W F ++ Y +L E Sbjct: 346 ISEAFYYDHIVSYYMLKQPDFVEGVNAQLITKTKNPKWSKSHEYHFKDLENYFKLPSE 403 >SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pombe|chr 1|||Manual Length = 1778 Score = 26.2 bits (55), Expect = 2.6 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 270 RKAWATMKENYSPIYLTFLTIHQIKRNYNALISKSKRTQTIC 395 RK +KE + L +H+I R NAL ++ T IC Sbjct: 1717 RKISVALKELNATNLLQKAALHKISRFVNALCNEESLTDAIC 1758 >SPAP32A8.02 |||xylose and arabinose reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 283 Score = 25.0 bits (52), Expect = 5.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 126 SWKGNPSYVPLGSISLEGIVSRGVEHV 46 SWK +V G I G+ + GV+H+ Sbjct: 127 SWKAMEEFVDSGDIRSVGVSNYGVKHL 153 >SPAC27E2.12 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 76 Score = 24.6 bits (51), Expect = 7.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 306 PIYLTFLTIHQIKRNYNALISKSKRTQTIC 395 P+Y + + R Y L+S + TQTIC Sbjct: 32 PLYCVVCFVSVLCRLYCILMSAASATQTIC 61 >SPCC1919.03c |||AMP-activated protein kinase beta subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 298 Score = 24.6 bits (51), Expect = 7.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 155 SVHTDRRIQTAGRGIHRMY 99 S HT RR QT+G+ H+ Y Sbjct: 76 SGHTKRRSQTSGKKTHQPY 94 >SPAC16E8.13 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 547 Score = 24.6 bits (51), Expect = 7.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 140 YPYEPTPKESEPFKSVGPDNKPF 208 YP E + S + VGP +KPF Sbjct: 173 YPMESSDSSSTEQQLVGPSSKPF 195 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,920,696 Number of Sequences: 5004 Number of extensions: 41428 Number of successful extensions: 96 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 184020746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -