BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31244 (355 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 2.8 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 3.7 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 20 6.5 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 20 6.5 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.4 bits (43), Expect = 2.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = +2 Query: 119 WQRQCRTRKGYFQFSRPWYSTKIKSKRALKALPLHWAVSALPLVVPSP 262 W + R + + + W + + A A H A ++LPL P P Sbjct: 118 WFQNRRMKDKRQRMAIAWPYAAVYTDPAFAASIFHAAATSLPLHYPPP 165 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.0 bits (42), Expect = 3.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 179 TKIKSKRALKALPLHWAVSALPLVVPSPQ 265 T++ + LP A S LPL+VP PQ Sbjct: 177 TRLANGDIALVLPTQGA-SPLPLLVPIPQ 204 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 20.2 bits (40), Expect = 6.5 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 184 LRTIPWSAKLEISFTCPALSLPKLSSAESP 95 ++ I K +SF L+ PKL + P Sbjct: 217 IKGISGGEKKRLSFAAEVLTNPKLMFCDEP 246 Score = 19.8 bits (39), Expect = 8.6 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = -1 Query: 70 CPNPESWCPNPGIMV 26 CPN + CP G ++ Sbjct: 614 CPNADLPCPKDGHVI 628 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 20.2 bits (40), Expect = 6.5 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 184 LRTIPWSAKLEISFTCPALSLPKLSSAESP 95 ++ I K +SF L+ PKL + P Sbjct: 217 IKGISGGEKKRLSFAAEVLTNPKLMFCDEP 246 Score = 19.8 bits (39), Expect = 8.6 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = -1 Query: 70 CPNPESWCPNPGIMV 26 CPN + CP G ++ Sbjct: 614 CPNADLPCPKDGHVI 628 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,168 Number of Sequences: 336 Number of extensions: 1570 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7087595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -