BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31243 (320 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC922.03 |||1-aminocyclopropane-1-carboxylate deaminase |Schiz... 31 0.033 SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizos... 26 1.6 SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 25 2.8 SPAC12B10.16c |mug157||conserved protein |Schizosaccharomyces po... 25 2.8 SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|ch... 25 3.8 SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces p... 25 3.8 SPBC3B8.06 |||conserved fungal protein|Schizosaccharomyces pombe... 25 3.8 >SPAC922.03 |||1-aminocyclopropane-1-carboxylate deaminase |Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 31.5 bits (68), Expect = 0.033 Identities = 13/32 (40%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 235 INLGGAE-DATRELPSIARDLGLDIVLVQEQY 143 +++GG + + TR++ ++A LGLD VL+QE + Sbjct: 71 VSIGGIQSNQTRQVAAVAAHLGLDCVLIQEDW 102 >SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizosaccharomyces pombe|chr 3|||Manual Length = 640 Score = 25.8 bits (54), Expect = 1.6 Identities = 16/59 (27%), Positives = 24/59 (40%) Frame = +2 Query: 143 ILFLYKNNIQAEIPCNGG*LPRRILCTTQIDLANTKSGPNIHTRPDLXSAPPHAGAPDS 319 ++ + N E+P +G L R +ID N+ N+HT S P A S Sbjct: 253 LIAVNNNRPPVELPKSGDVLSNREWEAGKIDAMNSLIAQNLHTSASQVSLSPMASTASS 311 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 25.0 bits (52), Expect = 2.8 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 42 AAKWCRTAQGSTLLRIYTPALG-CAPHWAR 128 A +W +T G++ + IY P LG AP+ +R Sbjct: 2260 APRWLQTLWGTSNIGIYVPFLGKGAPYLSR 2289 >SPAC12B10.16c |mug157||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 509 Score = 25.0 bits (52), Expect = 2.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 4 KSHPPMCTTVICVLLSGAEPRRGAPYCGYTHPP 102 KS P+ T ++ + + AE PYC PP Sbjct: 135 KSDSPLATLILGAIQTQAEMLIQFPYCNAFQPP 167 >SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 530 Score = 24.6 bits (51), Expect = 3.8 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 54 CRTAQGSTLLRIYTPALGCAPHWARNPTMEYCSCTRTISRPRSRAMEGSSLVASSAPP 227 CR + GST+L Y P + + + +CS I +R + S + ++PP Sbjct: 420 CRCSDGSTMLPAYCPII-------PSSEVNFCSIDNRIIAGMNRDLALDSDIIGNSPP 470 >SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 24.6 bits (51), Expect = 3.8 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 178 DPVQWRVAPSSHPLHHPD*FG 240 DP+ R PSSHPLH P G Sbjct: 477 DPLYTR--PSSHPLHPPPILG 495 >SPBC3B8.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 24.6 bits (51), Expect = 3.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 45 QHTYNGSAHWGVGLI 1 QH +NG AHW G I Sbjct: 239 QHIFNGLAHWIKGAI 253 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,642,857 Number of Sequences: 5004 Number of extensions: 37201 Number of successful extensions: 96 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 88030718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -