BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31236 (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 24 1.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.8 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 6.6 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 6.6 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 8.7 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 8.7 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 23.8 bits (49), Expect = 1.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 308 FQPLLLCIRQHACQDQCRLF 249 F +L + +HAC + CR+F Sbjct: 266 FNTVLELMPKHACSEYCRVF 285 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 118 AGHSRQISTYSSYHEYEHRWQTQGY-VCDDGYQRCWP 225 AG + + + +Y+E H +TQG+ V D +R P Sbjct: 1667 AGEYTRAAGFLAYYEICHNIKTQGWTVVQDPNRRMGP 1703 Score = 21.4 bits (43), Expect = 6.6 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +1 Query: 100 KLNQNVAGHSRQISTYSSYHEYEHRWQTQGYVCDDGYQRCW 222 +L N A +R I + E +W G D Y +CW Sbjct: 1488 RLVNNPAARARFIKHVLQFLE---KWNFDGLDLDWEYPKCW 1525 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 130 RQISTYSSYHEYEHRWQTQGYVCDDG 207 RQ+ + +H+ QT G DDG Sbjct: 46 RQVKVWFQNRRMKHKRQTLGKQGDDG 71 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 130 RQISTYSSYHEYEHRWQTQGYVCDDG 207 RQ+ + +H+ QT G DDG Sbjct: 177 RQVKVWFQNRRMKHKRQTLGKQGDDG 202 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +1 Query: 58 GCRNSARGFGNVG*KLNQNVAGHSRQISTYSSYHEYEHRW 177 GC + RG + + + S Q Y Y + E RW Sbjct: 229 GCFSLFRGKALMDKSVMKKYTTRSTQAKHYVQYDQGEDRW 268 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +1 Query: 58 GCRNSARGFGNVG*KLNQNVAGHSRQISTYSSYHEYEHRW 177 GC + RG + + + S Q Y Y + E RW Sbjct: 543 GCFSLFRGKALMDKSVMKKYTTRSTQAKHYVQYDQGEDRW 582 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +1 Query: 58 GCRNSARGFGNVG*KLNQNVAGHSRQISTYSSYHEYEHRW 177 GC + RG + + + S Q Y Y + E RW Sbjct: 776 GCFSLFRGKALMDKSVMKKYTTRSTQAKHYVQYDQGEDRW 815 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +1 Query: 58 GCRNSARGFGNVG*KLNQNVAGHSRQISTYSSYHEYEHRW 177 GC + RG + + + S Q Y Y + E RW Sbjct: 776 GCFSLFRGKALMDKSVMKKYTTRSTQAKHYVQYDQGEDRW 815 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 395 IYHQQYPFAYLGTSLVSYT 339 + HQ+ F+ LG +V YT Sbjct: 347 LLHQKVQFSVLGFFVVDYT 365 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,813 Number of Sequences: 336 Number of extensions: 3461 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -