BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31236 (645 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6482| Best HMM Match : No HMM Matches (HMM E-Value=.) 248 3e-66 SB_49538| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 48 9e-06 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 46 3e-05 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 46 3e-05 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 46 3e-05 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 46 3e-05 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 46 3e-05 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 45 5e-05 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 45 6e-05 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 45 6e-05 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 44 8e-05 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 44 8e-05 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 44 8e-05 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 44 8e-05 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 44 8e-05 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 44 1e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 44 1e-04 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 44 1e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 44 1e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 44 1e-04 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 44 1e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 44 1e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 44 1e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 44 1e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 44 1e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 44 1e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 44 1e-04 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 44 1e-04 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 44 1e-04 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 44 1e-04 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 43 2e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 2e-04 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 43 2e-04 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 43 2e-04 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 2e-04 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 43 2e-04 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 43 2e-04 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 43 2e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 43 2e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 2e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 43 2e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 43 2e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 43 2e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 43 2e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 43 2e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 43 2e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 43 2e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 43 2e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 43 2e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 43 2e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 43 2e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 43 2e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 43 2e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 43 2e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 43 2e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 43 2e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 43 2e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 43 2e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 43 2e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 43 2e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 43 2e-04 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 43 2e-04 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 43 2e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 43 2e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 43 2e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 43 2e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 43 2e-04 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 >SB_6482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 248 bits (607), Expect = 3e-66 Identities = 109/135 (80%), Positives = 128/135 (94%) Frame = +2 Query: 113 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT 292 MSLVIP+KFQHILR++NTNIDGK+K+MFAMT+IKGVGRRY+NIV KKADID++KRAGE T Sbjct: 1 MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIKGVGRRYANIVCKKADIDMNKRAGELT 60 Query: 293 EEEVEKIITIMSNPRQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAH 472 E+EVE+++TIM NPRQYKIPDWFLNRQKD DGKYSQ+ ++ LD+K+REDLERLKKIRAH Sbjct: 61 EDEVERVVTIMQNPRQYKIPDWFLNRQKDHKDGKYSQILANGLDNKMREDLERLKKIRAH 120 Query: 473 RGMRHYWGLRVRGQH 517 RG+RHYWGLRVRGQH Sbjct: 121 RGLRHYWGLRVRGQH 135 >SB_49538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 66.1 bits (154), Expect = 2e-11 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = +2 Query: 113 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIK 214 MSLVIP+KFQHILR++NTNIDGK+K+MFAMT+IK Sbjct: 1 MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIK 34 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 48.4 bits (110), Expect = 5e-06 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S+TL+ NSCSPG+PLV+ERPPPR S S Sbjct: 59 SRTLLSNSCSPGDPLVLERPPPRWSSNS 86 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 5e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 QT++ NSCSPG+PLV+ERPPPR S S Sbjct: 2 QTIISNSCSPGDPLVLERPPPRWSSNS 28 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +RS + V NSCSPG+PLV+ERPPPR S S Sbjct: 9 ERSASQVSNSCSPGDPLVLERPPPRWSSNS 38 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S+T++ NSCSPG+PLV+ERPPPR S S Sbjct: 16 SRTVLSNSCSPGDPLVLERPPPRWSSNS 43 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = -3 Query: 118 RHFG*VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 RHF + ++ L NSCSPG+PLV+ERPPPR S S Sbjct: 12 RHF--TGHAKNDALSSNSCSPGDPLVLERPPPRWSSNS 47 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S+TL NSCSPG+PLV+ERPPPR S S Sbjct: 11 SRTLRSNSCSPGDPLVLERPPPRWSSNS 38 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 T+V NSCSPG+PLV+ERPPPR S S Sbjct: 76 TIVSNSCSPGDPLVLERPPPRWSSNS 101 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S Q S T NSCSPG+PLV+ERPPPR S S Sbjct: 30 SRQLSITSTSNSCSPGDPLVLERPPPRWSSNS 61 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 VSNQ Q+ NSCSPG+PLV+ERPPPR S S Sbjct: 15 VSNQTKQS--SNSCSPGDPLVLERPPPRWSSNS 45 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +Q +V NSCSPG+PLV+ERPPPR S S Sbjct: 82 TQRIVSNSCSPGDPLVLERPPPRWSSNS 109 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -3 Query: 97 NQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 N +S+ + NSCSPG+PLV+ERPPPR S S Sbjct: 14 NTQSKLVASNSCSPGDPLVLERPPPRWSSNS 44 >SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 RS+ + NSCSPG+PLV+ERPPPR S S Sbjct: 2 RSRLITSNSCSPGDPLVLERPPPRWSSNS 30 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 TL+ NSCSPG+PLV+ERPPPR S S Sbjct: 1 TLLSNSCSPGDPLVLERPPPRWSSNS 26 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 T+V NSCSPG+PLV+ERPPPR S S Sbjct: 18 TVVSNSCSPGDPLVLERPPPRWSSNS 43 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -3 Query: 118 RHFG*VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 R++G S Q + L NSCSPG+PLV+ERPPPR S S Sbjct: 202 RYYG--SAQNGKHLRSNSCSPGDPLVLERPPPRWSSNS 237 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSSNS 57 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/34 (61%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = -3 Query: 103 VSNQR-SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +S R + LV NSCSPG+PLV+ERPPPR S S Sbjct: 8 ISRSRPGRLLVSNSCSPGDPLVLERPPPRWSSNS 41 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -3 Query: 97 NQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +Q S + NSCSPG+PLV+ERPPPR S S Sbjct: 2 SQSSPITISNSCSPGDPLVLERPPPRWSSNS 32 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +N R++ + NSCSPG+PLV+ERPPPR S S Sbjct: 126 TNLRARIVGSNSCSPGDPLVLERPPPRWSSNS 157 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSSNS 57 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 TL NSCSPG+PLV+ERPPPR S S Sbjct: 5 TLASNSCSPGDPLVLERPPPRWSSNS 30 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSSNS 57 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 R+ L+ NSCSPG+PLV+ERPPPR S S Sbjct: 2 RTAILLSNSCSPGDPLVLERPPPRWSSNS 30 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSSNS 57 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +S+ L NSCSPG+PLV+ERPPPR S S Sbjct: 81 KSEPLSSNSCSPGDPLVLERPPPRWSSNS 109 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSSNS 57 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSSNS 57 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +Q L NSCSPG+PLV+ERPPPR S S Sbjct: 8 TQELTSNSCSPGDPLVLERPPPRWSSNS 35 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 31 SISLISNSCSPGDPLVLERPPPRWSSNS 58 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S+ S ++ NSCSPG+PLV+ERPPPR S S Sbjct: 10 SSTTSAPVISNSCSPGDPLVLERPPPRWSSNS 41 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +V NSCSPG+PLV+ERPPPR S S Sbjct: 10 SANIVSNSCSPGDPLVLERPPPRWSSNS 37 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 TL NSCSPG+PLV+ERPPPR S S Sbjct: 2 TLASNSCSPGDPLVLERPPPRWSSNS 27 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q +V NSCSPG+PLV+ERPPPR S S Sbjct: 25 QKVVSNSCSPGDPLVLERPPPRWSSNS 51 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSSNS 57 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 28 SISLISNSCSPGDPLVLERPPPRWSSNS 55 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 LV NSCSPG+PLV+ERPPPR S S Sbjct: 24 LVSNSCSPGDPLVLERPPPRWSSNS 48 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q ++V NSCSPG+PLV+ERPPPR S S Sbjct: 342 QYLHSIVSNSCSPGDPLVLERPPPRWSSNS 371 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 LV NSCSPG+PLV+ERPPPR S S Sbjct: 3 LVSNSCSPGDPLVLERPPPRWSSNS 27 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 SN V NSCSPG+PLV+ERPPPR S S Sbjct: 24 SNSTPHFRVSNSCSPGDPLVLERPPPRWSSNS 55 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + +Q + NSCSPG+PLV+ERPPPR S S Sbjct: 3 SIREAQPVTSNSCSPGDPLVLERPPPRWSSNS 34 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 LV NSCSPG+PLV+ERPPPR S S Sbjct: 9 LVSNSCSPGDPLVLERPPPRWSSNS 33 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S ++ NSCSPG+PLV+ERPPPR S S Sbjct: 10 SANIISNSCSPGDPLVLERPPPRWSSNS 37 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 +L+ NSCSPG+PLV+ERPPPR S S Sbjct: 32 SLISNSCSPGDPLVLERPPPRWSSNS 57 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 LV NSCSPG+PLV+ERPPPR S S Sbjct: 5 LVSNSCSPGDPLVLERPPPRWSSNS 29 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 LV NSCSPG+PLV+ERPPPR S S Sbjct: 2 LVSNSCSPGDPLVLERPPPRWSSNS 26 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 R++ + NSCSPG+PLV+ERPPPR S S Sbjct: 41 RAEAALSNSCSPGDPLVLERPPPRWSSNS 69 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/35 (54%), Positives = 23/35 (65%) Frame = -3 Query: 109 G*VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 G + T+ NSCSPG+PLV+ERPPPR S S Sbjct: 36 GLTKSTTESTITSNSCSPGDPLVLERPPPRWSSNS 70 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 VS R + NSCSPG+PLV+ERPPPR S S Sbjct: 4 VSLDRESYALSNSCSPGDPLVLERPPPRWSSNS 36 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 3e-05 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = -3 Query: 121 QRHFG*VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +++F SNQR + NSCSPG+PLV+ERPPPR S S Sbjct: 5 KKYFEPDSNQRPRE--SNSCSPGDPLVLERPPPRWSSNS 41 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q L+ NSCSPG+PLV+ERPPPR S S Sbjct: 65 QHFPCLISNSCSPGDPLVLERPPPRWSSNS 94 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -3 Query: 97 NQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 N+ T NSCSPG+PLV+ERPPPR S S Sbjct: 14 NRLDLTFTSNSCSPGDPLVLERPPPRWSSNS 44 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 LV NSCSPG+PLV+ERPPPR S S Sbjct: 26 LVSNSCSPGDPLVLERPPPRWSSNS 50 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 T V NSCSPG+PLV+ERPPPR S S Sbjct: 8 TAVSNSCSPGDPLVLERPPPRWSSNS 33 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 LV NSCSPG+PLV+ERPPPR S S Sbjct: 26 LVSNSCSPGDPLVLERPPPRWSSNS 50 >SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) Length = 138 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = -3 Query: 112 FG*VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 FG S T NSCSPG+PLV+ERPPPR S S Sbjct: 2 FGIFSQFSRATKTSNSCSPGDPLVLERPPPRWSSNS 37 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S ++ NSCSPG+PLV+ERPPPR S S Sbjct: 10 SANIISNSCSPGDPLVLERPPPRWSSNS 37 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -3 Query: 97 NQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 N+R + NSCSPG+PLV+ERPPPR S S Sbjct: 44 NKRRVYVTSNSCSPGDPLVLERPPPRWSSNS 74 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = -3 Query: 127 NDQRHFG*VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +D +H + N+R NSCSPG+PLV+ERPPPR S S Sbjct: 58 SDLKHLRMIENRRGS----NSCSPGDPLVLERPPPRWSSNS 94 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/33 (63%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -3 Query: 97 NQRSQTL--VPNSCSPGEPLVIERPPPRGSXQS 5 NQ Q L + NSCSPG+PLV+ERPPPR S S Sbjct: 3 NQSKQCLLEISNSCSPGDPLVLERPPPRWSSNS 35 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L+ NSCSPG+PLV+ERPPPR S S Sbjct: 17 LISNSCSPGDPLVLERPPPRWSSNS 41 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -3 Query: 97 NQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 N + V NSCSPG+PLV+ERPPPR S S Sbjct: 3 NYNAVLFVSNSCSPGDPLVLERPPPRWSSNS 33 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 V + + ++ NSCSPG+PLV+ERPPPR S S Sbjct: 111 VRAKNQKEIISNSCSPGDPLVLERPPPRWSSNS 143 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L+ NSCSPG+PLV+ERPPPR S S Sbjct: 37 LISNSCSPGDPLVLERPPPRWSSNS 61 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 + Q + NSCSPG+PLV+ERPPPR S S Sbjct: 78 KRQQMASNSCSPGDPLVLERPPPRWSSNS 106 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 45.2 bits (102), Expect = 5e-05 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 9/103 (8%) Frame = -3 Query: 286 FASTLVKINVGFFENN---VGVPPANTFDSRHRKHNLAFAIDVRIHDTKNMLKFVWNDQR 116 F TL+ N+G + V + D+R+R+ + V ++ + DQ+ Sbjct: 4 FTDTLISANIGTKAGTGPPLEVDGIDKLDTRYRQIVETSSCKVLKSADRSAIS---GDQK 60 Query: 115 HFG*VSN-----QRSQTLVP-NSCSPGEPLVIERPPPRGSXQS 5 H V+ QRS+ + NSCSPG+PLV+ERPPPR S S Sbjct: 61 HSSNVAKVHCRKQRSREVATSNSCSPGDPLVLERPPPRWSSNS 103 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L+ NSCSPG+PLV+ERPPPR S S Sbjct: 8 LISNSCSPGDPLVLERPPPRWSSNS 32 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/46 (47%), Positives = 29/46 (63%) Frame = -3 Query: 142 LKFVWNDQRHFG*VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 L +VW+D + + + L NSCSPG+PLV+ERPPPR S S Sbjct: 10 LLYVWHDTK----APFKPGKHLPSNSCSPGDPLVLERPPPRWSSNS 51 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 V Q+ + NSCSPG+PLV+ERPPPR S S Sbjct: 26 VRTQKPVIFLSNSCSPGDPLVLERPPPRWSSNS 58 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 + N S + NSCSPG+PLV+ERPPPR S S Sbjct: 11 ICNSLSYSFRSNSCSPGDPLVLERPPPRWSSNS 43 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L+ NSCSPG+PLV+ERPPPR S S Sbjct: 24 LISNSCSPGDPLVLERPPPRWSSNS 48 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 T+ NSCSPG+PLV+ERPPPR S S Sbjct: 3 TIASNSCSPGDPLVLERPPPRWSSNS 28 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -3 Query: 97 NQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 N R+ V NSCSPG+PLV+ERPPPR S S Sbjct: 52 NLRTIPPVSNSCSPGDPLVLERPPPRWSSNS 82 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L+ NSCSPG+PLV+ERPPPR S S Sbjct: 40 LISNSCSPGDPLVLERPPPRWSSNS 64 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L+ NSCSPG+PLV+ERPPPR S S Sbjct: 21 LISNSCSPGDPLVLERPPPRWSSNS 45 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S L+ NSCSPG+PLV+ERPPPR S S Sbjct: 4 SSFLLSNSCSPGDPLVLERPPPRWSSNS 31 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L+ NSCSPG+PLV+ERPPPR S S Sbjct: 16 LISNSCSPGDPLVLERPPPRWSSNS 40 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 VS + V NSCSPG+PLV+ERPPPR S S Sbjct: 8 VSVDKIADFVSNSCSPGDPLVLERPPPRWSSNS 40 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 + R ++ NSCSPG+PLV+ERPPPR S S Sbjct: 11 IKMSRKVSITSNSCSPGDPLVLERPPPRWSSNS 43 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q L NSCSPG+PLV+ERPPPR S S Sbjct: 23 QLLPSNSCSPGDPLVLERPPPRWSSNS 49 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 T + NSCSPG+PLV+ERPPPR S S Sbjct: 513 TFLSNSCSPGDPLVLERPPPRWSSNS 538 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 +T+ NSCSPG+PLV+ERPPPR S S Sbjct: 9 RTISSNSCSPGDPLVLERPPPRWSSNS 35 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S ++ NSCSPG+PLV+ERPPPR S S Sbjct: 10 SANILSNSCSPGDPLVLERPPPRWSSNS 37 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 6e-05 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = -3 Query: 121 QRHFG*VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 QRH +S++RS + NSCSPG+PLV+ERPPPR S S Sbjct: 33 QRH---LSHKRSSS---NSCSPGDPLVLERPPPRWSSNS 65 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = -3 Query: 91 RSQTLVP-NSCSPGEPLVIERPPPRGSXQS 5 +SQT V NSCSPG+PLV+ERPPPR S S Sbjct: 17 QSQTRVTSNSCSPGDPLVLERPPPRWSSNS 46 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/32 (62%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -3 Query: 97 NQRSQTL-VPNSCSPGEPLVIERPPPRGSXQS 5 N+R + L NSCSPG+PLV+ERPPPR S S Sbjct: 4 NKRDERLSTSNSCSPGDPLVLERPPPRWSSNS 35 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +R + NSCSPG+PLV+ERPPPR S S Sbjct: 60 RRKSSTTSNSCSPGDPLVLERPPPRWSSNS 89 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +SN + NSCSPG+PLV+ERPPPR S S Sbjct: 20 ISNILIPKIASNSCSPGDPLVLERPPPRWSSNS 52 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +N S V NSCSPG+PLV+ERPPPR S S Sbjct: 11 ANIISIAFVSNSCSPGDPLVLERPPPRWSSNS 42 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S V NSCSPG+PLV+ERPPPR S S Sbjct: 7 SNDAVSNSCSPGDPLVLERPPPRWSSNS 34 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 +V NSCSPG+PLV+ERPPPR S S Sbjct: 11 MVSNSCSPGDPLVLERPPPRWSSNS 35 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 + L NSCSPG+PLV+ERPPPR S S Sbjct: 15 EVLASNSCSPGDPLVLERPPPRWSSNS 41 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + NSCSPG+PLV+ERPPPR S S Sbjct: 2418 SSAIASNSCSPGDPLVLERPPPRWSSNS 2445 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 +V NSCSPG+PLV+ERPPPR S S Sbjct: 1 MVSNSCSPGDPLVLERPPPRWSSNS 25 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 +T+ NSCSPG+PLV+ERPPPR S S Sbjct: 43 ETVPSNSCSPGDPLVLERPPPRWSSNS 69 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +R NSCSPG+PLV+ERPPPR S S Sbjct: 18 ERQHVAASNSCSPGDPLVLERPPPRWSSNS 47 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 +T+ NSCSPG+PLV+ERPPPR S S Sbjct: 21 KTISSNSCSPGDPLVLERPPPRWSSNS 47 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 +V NSCSPG+PLV+ERPPPR S S Sbjct: 6 IVSNSCSPGDPLVLERPPPRWSSNS 30 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 ++L NSCSPG+PLV+ERPPPR S S Sbjct: 13 KSLTSNSCSPGDPLVLERPPPRWSSNS 39 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 +V NSCSPG+PLV+ERPPPR S S Sbjct: 1 MVSNSCSPGDPLVLERPPPRWSSNS 25 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -3 Query: 97 NQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 N+ ++ NSCSPG+PLV+ERPPPR S S Sbjct: 19 NKCHNIVISNSCSPGDPLVLERPPPRWSSNS 49 >SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +R Q NSCSPG+PLV+ERPPPR S S Sbjct: 36 RRLQISTSNSCSPGDPLVLERPPPRWSSNS 65 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + NSCSPG+PLV+ERPPPR S S Sbjct: 10 SANIASNSCSPGDPLVLERPPPRWSSNS 37 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 ++ NSCSPG+PLV+ERPPPR S S Sbjct: 17 IISNSCSPGDPLVLERPPPRWSSNS 41 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 + S + NSCSPG+PLV+ERPPPR S S Sbjct: 16 RNSSNISSNSCSPGDPLVLERPPPRWSSNS 45 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 +V NSCSPG+PLV+ERPPPR S S Sbjct: 3474 VVSNSCSPGDPLVLERPPPRWSSNS 3498 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 ++ NSCSPG+PLV+ERPPPR S S Sbjct: 14 IISNSCSPGDPLVLERPPPRWSSNS 38 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +S + NSCSPG+PLV+ERPPPR S S Sbjct: 47 KSSSRASNSCSPGDPLVLERPPPRWSSNS 75 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 +V NSCSPG+PLV+ERPPPR S S Sbjct: 7 VVSNSCSPGDPLVLERPPPRWSSNS 31 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L+ NSCSPG+PLV+ERPPPR S S Sbjct: 54 LLSNSCSPGDPLVLERPPPRWSSNS 78 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + NSCSPG+PLV+ERPPPR S S Sbjct: 10 SANITSNSCSPGDPLVLERPPPRWSSNS 37 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 V+ + S NSCSPG+PLV+ERPPPR S S Sbjct: 16 VTTRESTPFGSNSCSPGDPLVLERPPPRWSSNS 48 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 ++ NSCSPG+PLV+ERPPPR S S Sbjct: 5 IISNSCSPGDPLVLERPPPRWSSNS 29 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 + V NSCSPG+PLV+ERPPPR S S Sbjct: 12 SFVSNSCSPGDPLVLERPPPRWSSNS 37 >SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 T NSCSPG+PLV+ERPPPR S S Sbjct: 3 TFTSNSCSPGDPLVLERPPPRWSSNS 28 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 + L NSCSPG+PLV+ERPPPR S S Sbjct: 35 RVLTSNSCSPGDPLVLERPPPRWSSNS 61 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 44.4 bits (100), Expect = 8e-05 Identities = 21/33 (63%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -3 Query: 100 SNQRSQT-LVPNSCSPGEPLVIERPPPRGSXQS 5 SN R L NSCSPG+PLV+ERPPPR S S Sbjct: 12 SNVREAAPLASNSCSPGDPLVLERPPPRWSSNS 44 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 ++ NSCSPG+PLV+ERPPPR S S Sbjct: 1 MISNSCSPGDPLVLERPPPRWSSNS 25 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L+ NSCSPG+PLV+ERPPPR S S Sbjct: 1 LLSNSCSPGDPLVLERPPPRWSSNS 25 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/26 (76%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -3 Query: 79 LVP-NSCSPGEPLVIERPPPRGSXQS 5 LVP NSCSPG+PLV+ERPPPR S S Sbjct: 27 LVPSNSCSPGDPLVLERPPPRWSSNS 52 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + V NSCSPG+PLV+ERPPPR S S Sbjct: 15 SEPKRVNAVSNSCSPGDPLVLERPPPRWSSNS 46 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +S + V NSCSPG+PLV+ERPPPR S S Sbjct: 9 ISANIANAKVSNSCSPGDPLVLERPPPRWSSNS 41 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q + NSCSPG+PLV+ERPPPR S S Sbjct: 156 QWIASNSCSPGDPLVLERPPPRWSSNS 182 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S L NSCSPG+PLV+ERPPPR S S Sbjct: 658 SLQLASNSCSPGDPLVLERPPPRWSSNS 685 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + + NSCSPG+PLV+ERPPPR S S Sbjct: 2 STSKISNSCSPGDPLVLERPPPRWSSNS 29 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 + L NSCSPG+PLV+ERPPPR S S Sbjct: 5 EPLASNSCSPGDPLVLERPPPRWSSNS 31 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 ++ NSCSPG+PLV+ERPPPR S S Sbjct: 26 IISNSCSPGDPLVLERPPPRWSSNS 50 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q Q + NSCSPG+PLV+ERPPPR S S Sbjct: 10 QTYQRVESNSCSPGDPLVLERPPPRWSSNS 39 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 + L NSCSPG+PLV+ERPPPR S S Sbjct: 94 RALASNSCSPGDPLVLERPPPRWSSNS 120 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 + L NSCSPG+PLV+ERPPPR S S Sbjct: 2 RVLASNSCSPGDPLVLERPPPRWSSNS 28 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 T NSCSPG+PLV+ERPPPR S S Sbjct: 7 TTTSNSCSPGDPLVLERPPPRWSSNS 32 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 30 VSNSCSPGDPLVLERPPPRWSSNS 53 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 7 VSNSCSPGDPLVLERPPPRWSSNS 30 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/33 (54%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -3 Query: 100 SNQRSQTLVP-NSCSPGEPLVIERPPPRGSXQS 5 ++++++ +P NSCSPG+PLV+ERPPPR S S Sbjct: 11 ASRKTRKKIPSNSCSPGDPLVLERPPPRWSSNS 43 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +N + + NSCSPG+PLV+ERPPPR S S Sbjct: 11 ANIKGRHCASNSCSPGDPLVLERPPPRWSSNS 42 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +R NSCSPG+PLV+ERPPPR S S Sbjct: 14 RRGSQTASNSCSPGDPLVLERPPPRWSSNS 43 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 2 VSNSCSPGDPLVLERPPPRWSSNS 25 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L NSCSPG+PLV+ERPPPR S S Sbjct: 15 LTSNSCSPGDPLVLERPPPRWSSNS 39 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 40 VSNSCSPGDPLVLERPPPRWSSNS 63 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 117 VSNSCSPGDPLVLERPPPRWSSNS 140 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 184 VSNSCSPGDPLVLERPPPRWSSNS 207 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 34 VSNSCSPGDPLVLERPPPRWSSNS 57 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/27 (62%), Positives = 22/27 (81%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 + ++ NSCSPG+PLV+ERPPPR S S Sbjct: 53 EPILSNSCSPGDPLVLERPPPRWSSNS 79 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +N R Q NSCSPG+PLV+ERPPPR S S Sbjct: 1 NNSRFQA-TSNSCSPGDPLVLERPPPRWSSNS 31 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 1066 VSNSCSPGDPLVLERPPPRWSSNS 1089 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 ++ NSCSPG+PLV+ERPPPR S S Sbjct: 14 VISNSCSPGDPLVLERPPPRWSSNS 38 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L NSCSPG+PLV+ERPPPR S S Sbjct: 78 LTSNSCSPGDPLVLERPPPRWSSNS 102 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 3 VSNSCSPGDPLVLERPPPRWSSNS 26 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 214 VSNSCSPGDPLVLERPPPRWSSNS 237 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -3 Query: 97 NQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 N S T NSCSPG+PLV+ERPPPR S S Sbjct: 19 NSNSHT-ASNSCSPGDPLVLERPPPRWSSNS 48 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L NSCSPG+PLV+ERPPPR S S Sbjct: 5 LASNSCSPGDPLVLERPPPRWSSNS 29 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q + NSCSPG+PLV+ERPPPR S S Sbjct: 18 QWQISNSCSPGDPLVLERPPPRWSSNS 44 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 5 VSNSCSPGDPLVLERPPPRWSSNS 28 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = -3 Query: 85 QTLVP-NSCSPGEPLVIERPPPRGSXQS 5 QT +P NSCSPG+PLV+ERPPPR S S Sbjct: 3 QTGLPSNSCSPGDPLVLERPPPRWSSNS 30 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 3 VSNSCSPGDPLVLERPPPRWSSNS 26 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 7 VSNSCSPGDPLVLERPPPRWSSNS 30 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 64 VSNSCSPGDPLVLERPPPRWSSNS 87 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 4 VSNSCSPGDPLVLERPPPRWSSNS 27 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 4 VSNSCSPGDPLVLERPPPRWSSNS 27 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 25 VSNSCSPGDPLVLERPPPRWSSNS 48 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 15 VSNSCSPGDPLVLERPPPRWSSNS 38 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 R + + NSCSPG+PLV+ERPPPR S S Sbjct: 969 RRKGWISNSCSPGDPLVLERPPPRWSSNS 997 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 10 VSNSCSPGDPLVLERPPPRWSSNS 33 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 ++++ NSCSPG+PLV+ERPPPR S S Sbjct: 46 RKTEDTTSNSCSPGDPLVLERPPPRWSSNS 75 >SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q+ NSCSPG+PLV+ERPPPR S S Sbjct: 2 QSSTSNSCSPGDPLVLERPPPRWSSNS 28 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 31 VSNSCSPGDPLVLERPPPRWSSNS 54 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 4 VSNSCSPGDPLVLERPPPRWSSNS 27 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 41 VSNSCSPGDPLVLERPPPRWSSNS 64 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 15 VSNSCSPGDPLVLERPPPRWSSNS 38 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + ++ NSCSPG+PLV+ERPPPR S S Sbjct: 6 SELEKRQVLSNSCSPGDPLVLERPPPRWSSNS 37 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 4 VSNSCSPGDPLVLERPPPRWSSNS 27 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 6 VSNSCSPGDPLVLERPPPRWSSNS 29 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 ++ NSCSPG+PLV+ERPPPR S S Sbjct: 5 VISNSCSPGDPLVLERPPPRWSSNS 29 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 15 VSNSCSPGDPLVLERPPPRWSSNS 38 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 18 VSNSCSPGDPLVLERPPPRWSSNS 41 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 30 VSNSCSPGDPLVLERPPPRWSSNS 53 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 32 VSNSCSPGDPLVLERPPPRWSSNS 55 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 17 VSNSCSPGDPLVLERPPPRWSSNS 40 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 14 VSNSCSPGDPLVLERPPPRWSSNS 37 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 34 VSNSCSPGDPLVLERPPPRWSSNS 57 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L NSCSPG+PLV+ERPPPR S S Sbjct: 88 LTSNSCSPGDPLVLERPPPRWSSNS 112 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L NSCSPG+PLV+ERPPPR S S Sbjct: 11 LASNSCSPGDPLVLERPPPRWSSNS 35 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + NSCSPG+PLV+ERPPPR S S Sbjct: 34 STQMASNSCSPGDPLVLERPPPRWSSNS 61 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S ++ NSCSPG+PLV+ERPPPR S S Sbjct: 101 STFILSNSCSPGDPLVLERPPPRWSSNS 128 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 8 VSNSCSPGDPLVLERPPPRWSSNS 31 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 10 VSNSCSPGDPLVLERPPPRWSSNS 33 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L NSCSPG+PLV+ERPPPR S S Sbjct: 11 LASNSCSPGDPLVLERPPPRWSSNS 35 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 27 VSNSCSPGDPLVLERPPPRWSSNS 50 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 193 VSNSCSPGDPLVLERPPPRWSSNS 216 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 9 VSNSCSPGDPLVLERPPPRWSSNS 32 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + NSCSPG+PLV+ERPPPR S S Sbjct: 9 SDIVASNSCSPGDPLVLERPPPRWSSNS 36 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 L NSCSPG+PLV+ERPPPR S S Sbjct: 11 LTSNSCSPGDPLVLERPPPRWSSNS 35 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -3 Query: 115 HFG*VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 HFG SQT NSCSPG+PLV+ERPPPR S S Sbjct: 6 HFG----LHSQT-TSNSCSPGDPLVLERPPPRWSSNS 37 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 + +++ NSCSPG+PLV+ERPPPR S S Sbjct: 30 KQESIRSNSCSPGDPLVLERPPPRWSSNS 58 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 V NSCSPG+PLV+ERPPPR S S Sbjct: 10 VSNSCSPGDPLVLERPPPRWSSNS 33 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -3 Query: 100 SNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 + QR + L NSCSPG+PLV+ERPPPR S S Sbjct: 27 AKQRMEYL-SNSCSPGDPLVLERPPPRWSSNS 57 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 5 ISNSCSPGDPLVLERPPPRWSSNS 28 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 101 ISNSCSPGDPLVLERPPPRWSSNS 124 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 261 ISNSCSPGDPLVLERPPPRWSSNS 284 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 16 ISNSCSPGDPLVLERPPPRWSSNS 39 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/28 (71%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = -3 Query: 85 QTLVP-NSCSPGEPLVIERPPPRGSXQS 5 Q VP NSCSPG+PLV+ERPPPR S S Sbjct: 38 QANVPSNSCSPGDPLVLERPPPRWSSNS 65 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 V+N R ++ NSCSPG+PLV+ERPPPR S S Sbjct: 16 VTNSRPRS---NSCSPGDPLVLERPPPRWSSNS 45 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 21 ISNSCSPGDPLVLERPPPRWSSNS 44 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 R ++ NSCSPG+PLV+ERPPPR S S Sbjct: 8 RITKVLSNSCSPGDPLVLERPPPRWSSNS 36 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 +T NSCSPG+PLV+ERPPPR S S Sbjct: 13 RTPTSNSCSPGDPLVLERPPPRWSSNS 39 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 T+ NSCSPG+PLV+ERPPPR S S Sbjct: 9 TVGSNSCSPGDPLVLERPPPRWSSNS 34 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 59 ISNSCSPGDPLVLERPPPRWSSNS 82 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +S + NSCSPG+PLV+ERPPPR S S Sbjct: 13 KSFRVTSNSCSPGDPLVLERPPPRWSSNS 41 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 10 ISNSCSPGDPLVLERPPPRWSSNS 33 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 3 ISNSCSPGDPLVLERPPPRWSSNS 26 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 13 ISNSCSPGDPLVLERPPPRWSSNS 36 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 4 ISNSCSPGDPLVLERPPPRWSSNS 27 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 52 ISNSCSPGDPLVLERPPPRWSSNS 75 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 51 ISNSCSPGDPLVLERPPPRWSSNS 74 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 +L NSCSPG+PLV+ERPPPR S S Sbjct: 3 SLSSNSCSPGDPLVLERPPPRWSSNS 28 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 16 ISNSCSPGDPLVLERPPPRWSSNS 39 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/28 (67%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = -3 Query: 85 QTLVP-NSCSPGEPLVIERPPPRGSXQS 5 Q + P NSCSPG+PLV+ERPPPR S S Sbjct: 18 QVIYPSNSCSPGDPLVLERPPPRWSSNS 45 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 152 ISNSCSPGDPLVLERPPPRWSSNS 175 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 4 ISNSCSPGDPLVLERPPPRWSSNS 27 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 47 ISNSCSPGDPLVLERPPPRWSSNS 70 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 7 ISNSCSPGDPLVLERPPPRWSSNS 30 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 4 ISNSCSPGDPLVLERPPPRWSSNS 27 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 32 ISNSCSPGDPLVLERPPPRWSSNS 55 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 SQ NSCSPG+PLV+ERPPPR S S Sbjct: 88 SQHARSNSCSPGDPLVLERPPPRWSSNS 115 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + NSCSPG+PLV+ERPPPR S S Sbjct: 19 SYEVTSNSCSPGDPLVLERPPPRWSSNS 46 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 91 RSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 R L NSCSPG+PLV+ERPPPR S S Sbjct: 62 RFPKLSSNSCSPGDPLVLERPPPRWSSNS 90 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 18 ISNSCSPGDPLVLERPPPRWSSNS 41 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 32 ISNSCSPGDPLVLERPPPRWSSNS 55 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q NSCSPG+PLV+ERPPPR S S Sbjct: 10 QQATSNSCSPGDPLVLERPPPRWSSNS 36 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 T NSCSPG+PLV+ERPPPR S S Sbjct: 33 TKTSNSCSPGDPLVLERPPPRWSSNS 58 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 6 ISNSCSPGDPLVLERPPPRWSSNS 29 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 79 LVPNSCSPGEPLVIERPPPRGSXQS 5 ++ NSCSPG+PLV+ERPPPR S S Sbjct: 65 MLSNSCSPGDPLVLERPPPRWSSNS 89 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -3 Query: 94 QRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q+ + NSCSPG+PLV+ERPPPR S S Sbjct: 7 QKFYRIQSNSCSPGDPLVLERPPPRWSSNS 36 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 + S+ NSCSPG+PLV+ERPPPR S S Sbjct: 17 IKTANSKATRSNSCSPGDPLVLERPPPRWSSNS 49 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + NSCSPG+PLV+ERPPPR S S Sbjct: 10 SANIPSNSCSPGDPLVLERPPPRWSSNS 37 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 88 SQTLVPNSCSPGEPLVIERPPPRGSXQS 5 S + NSCSPG+PLV+ERPPPR S S Sbjct: 10 SANIQSNSCSPGDPLVLERPPPRWSSNS 37 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 1 ISNSCSPGDPLVLERPPPRWSSNS 24 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 5 ISNSCSPGDPLVLERPPPRWSSNS 28 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 + + NSCSPG+PLV+ERPPPR S S Sbjct: 8 KVITSNSCSPGDPLVLERPPPRWSSNS 34 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -3 Query: 103 VSNQRSQTLVPNSCSPGEPLVIERPPPRGSXQS 5 +S +++ NSCSPG+PLV+ERPPPR S S Sbjct: 3 LSYKQTDDRTSNSCSPGDPLVLERPPPRWSSNS 35 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 32 ISNSCSPGDPLVLERPPPRWSSNS 55 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 116 ISNSCSPGDPLVLERPPPRWSSNS 139 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 82 TLVPNSCSPGEPLVIERPPPRGSXQS 5 +L NSCSPG+PLV+ERPPPR S S Sbjct: 5 SLSSNSCSPGDPLVLERPPPRWSSNS 30 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 2 ISNSCSPGDPLVLERPPPRWSSNS 25 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 2 ISNSCSPGDPLVLERPPPRWSSNS 25 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 14 ISNSCSPGDPLVLERPPPRWSSNS 37 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 2 ISNSCSPGDPLVLERPPPRWSSNS 25 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 76 VPNSCSPGEPLVIERPPPRGSXQS 5 + NSCSPG+PLV+ERPPPR S S Sbjct: 8 ISNSCSPGDPLVLERPPPRWSSNS 31 >SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -3 Query: 85 QTLVPNSCSPGEPLVIERPPPRGSXQS 5 Q NSCSPG+PLV+ERPPPR S S Sbjct: 5 QVQTSNSCSPGDPLVLERPPPRWSSNS 31 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,386,181 Number of Sequences: 59808 Number of extensions: 414594 Number of successful extensions: 3369 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3368 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -