BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31232 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 234 6e-62 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 233 8e-62 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 232 2e-61 SB_56| Best HMM Match : Actin (HMM E-Value=0) 232 2e-61 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 232 2e-61 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 230 7e-61 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 206 1e-53 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 76 3e-14 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 68 8e-12 SB_54| Best HMM Match : Actin (HMM E-Value=0) 57 1e-08 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 42 4e-04 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 42 4e-04 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 42 4e-04 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 42 4e-04 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 42 4e-04 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 42 4e-04 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 42 6e-04 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 41 0.001 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.006 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.014 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 37 0.018 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 37 0.018 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 37 0.018 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 37 0.018 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 37 0.018 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 37 0.018 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 37 0.018 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 37 0.018 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 37 0.018 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 37 0.018 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 37 0.018 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 37 0.018 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 37 0.018 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 37 0.018 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 37 0.018 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 37 0.018 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 37 0.018 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 37 0.018 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 37 0.018 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 37 0.018 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 37 0.018 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 37 0.018 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 37 0.018 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 37 0.018 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 37 0.018 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 37 0.018 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 37 0.018 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 37 0.018 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 37 0.018 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 37 0.018 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 37 0.018 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 37 0.018 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 37 0.018 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 37 0.018 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 37 0.018 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 37 0.018 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 37 0.018 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 37 0.018 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 37 0.018 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 37 0.018 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 37 0.018 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 37 0.018 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 37 0.018 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 37 0.018 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 37 0.018 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 37 0.018 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 37 0.018 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 37 0.018 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 37 0.018 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 37 0.018 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 37 0.018 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 37 0.018 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 37 0.018 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 37 0.018 SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_11016| Best HMM Match : DUF726 (HMM E-Value=1.3e-08) 37 0.018 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 37 0.018 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_9919| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 37 0.018 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 37 0.018 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_8043| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7679| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 37 0.018 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7304| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 37 0.018 SB_7027| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_6958| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_5084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_4603| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 37 0.018 SB_4554| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_4385| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_4363| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_4332| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 37 0.018 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 37 0.018 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_3391| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 37 0.018 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_2377| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_2289| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_2177| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1887| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1459| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1407| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1055| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 234 bits (572), Expect = 6e-62 Identities = 108/116 (93%), Positives = 112/116 (96%) Frame = +1 Query: 16 ALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITA 195 AL QPSFLGMES GIHET YNSIMKCDVDIRKDLYANTVMSGGTTMYPG+ADRMQKEI+A Sbjct: 234 ALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISA 293 Query: 196 LAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 363 LAPST+KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 294 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 349 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 233 bits (571), Expect = 8e-62 Identities = 107/116 (92%), Positives = 112/116 (96%) Frame = +1 Query: 16 ALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITA 195 A+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGGTTMYPGIADRMQKEI+A Sbjct: 223 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEISA 282 Query: 196 LAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 363 LAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 283 LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 338 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 232 bits (568), Expect = 2e-61 Identities = 106/116 (91%), Positives = 112/116 (96%) Frame = +1 Query: 16 ALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITA 195 A+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGG+TMYPGIADRMQKEIT+ Sbjct: 261 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITS 320 Query: 196 LAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 363 LAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 321 LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 232 bits (568), Expect = 2e-61 Identities = 106/116 (91%), Positives = 112/116 (96%) Frame = +1 Query: 16 ALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITA 195 A+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGG+TMYPGIADRMQKEIT+ Sbjct: 260 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITS 319 Query: 196 LAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 363 LAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 320 LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 232 bits (567), Expect = 2e-61 Identities = 106/116 (91%), Positives = 112/116 (96%) Frame = +1 Query: 16 ALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITA 195 A+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGG+TMYPGIADRMQKEI+A Sbjct: 261 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISA 320 Query: 196 LAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 363 LAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 321 LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 230 bits (563), Expect = 7e-61 Identities = 105/116 (90%), Positives = 112/116 (96%) Frame = +1 Query: 16 ALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITA 195 A+FQPSFLGMES GIHET YNSIMKCDVDIRKDLYANTV+SGG+TM+PGIADRMQKEI+A Sbjct: 260 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISA 319 Query: 196 LAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 363 LAP T+KIKIIAPPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 320 LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 206 bits (504), Expect = 1e-53 Identities = 92/116 (79%), Positives = 106/116 (91%) Frame = +1 Query: 16 ALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITA 195 A+FQP+FLGME+ GIHE +YN IMKCDVDIRKDLY+N V+SGG+TM+PGIADRMQKEI Sbjct: 34 AMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYSNCVLSGGSTMFPGIADRMQKEIAM 93 Query: 196 LAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 363 LA +++K+K+IAPPERKYSVWIGGSILASLSTFQQMWI+KEEY E GP IVHRKCF Sbjct: 94 LANASMKVKVIAPPERKYSVWIGGSILASLSTFQQMWIAKEEYHEYGPPIVHRKCF 149 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 75.8 bits (178), Expect = 3e-14 Identities = 43/131 (32%), Positives = 67/131 (51%), Gaps = 17/131 (12%) Frame = +1 Query: 22 FQPSFLGME-SCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEIT-- 192 F P F + + + E V N I C +D+R+ LY N V+SGG+TM+ R+Q++I Sbjct: 210 FHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDIKRT 269 Query: 193 --------------ALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDE 330 + P I+ ++I+ ++Y+VW GGS+LAS F + +K +YDE Sbjct: 270 VDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTPEFYSVCHTKADYDE 329 Query: 331 SGPGIVHRKCF 363 GP I F Sbjct: 330 HGPSICRHNPF 340 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 71.7 bits (168), Expect = 5e-13 Identities = 46/136 (33%), Positives = 72/136 (52%), Gaps = 29/136 (21%) Frame = +1 Query: 16 ALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITA 195 ALFQP + +E G+ E ++N+I D+D R + Y + V+SGG+TMYPG+ R+++EI Sbjct: 264 ALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLEREIKQ 323 Query: 196 L---------------------APSTI-----KIKI-IAPP-ERKYSVWIGGSILAS-LS 288 L P T K KI I P RK+ V++GG++LA + Sbjct: 324 LYLERVLKGDTSKLSSGMGMEQIPLTADYLLQKFKIRIEDPPRRKHMVFMGGAVLADIMK 383 Query: 289 TFQQMWISKEEYDESG 336 W++++EY+E G Sbjct: 384 DKDSFWMTRKEYEEKG 399 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 67.7 bits (158), Expect = 8e-12 Identities = 29/85 (34%), Positives = 55/85 (64%), Gaps = 3/85 (3%) Frame = +1 Query: 40 GMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKI 219 G + G+ + V S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P ++++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 220 KII---APPERKYSVWIGGSILASL 285 K+I + E++++ WIGGSILASL Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 57.2 bits (132), Expect = 1e-08 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 19 LFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSG 141 LFQPS LG + GIHE+++ SI KCD+D+R +L+ N V+SG Sbjct: 2306 LFQPSLLGRDIDGIHESIFKSIKKCDIDLRAELFHNIVLSG 2346 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 54.0 bits (124), Expect = 1e-07 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 9/104 (8%) Frame = +1 Query: 46 ESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST----- 210 E + + +S++ C +D RK L N V+ GGT M PG R+ +EI L S Sbjct: 54 EEKSLATALLDSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDK 113 Query: 211 --IK-IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKEEYDE 330 IK +K+ PP + W+GG+I SL ++E Y + Sbjct: 114 LFIKTVKMHQPPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 6 DVVKRRPVNCNTTHYRA 22 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 62 DVVKRRPVNCNTTHYRA 78 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 630 DVVKRRPVNCNTTHYRA 646 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 41 DVVKRRPVNCNTTHYRA 57 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 3 DVVKRRPVNCNTTHYRA 19 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 43 DVVKRRPVNCNTTHYRA 59 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 1881 DVVKRRPVNCNTTHYRA 1897 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 41 DVVKRRPVNCNTTHYRA 57 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 3 DVVKRRPVNCNTTHYRA 19 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 23 DVVKRRPVNCNTTHYRA 39 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 35 DVVKRRPVNCNTTHYRA 51 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 84 DVVKRRPVNCNTTHYRA 100 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 62 DVVKRRPVNCNTTHYRA 78 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 73 DVVKRRPVNCNTTHYRA 89 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 49 DVVKRRPVNCNTTHYRA 65 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 DVVKRRPVNCNTTHYRA Sbjct: 73 DVVKRRPVNCNTTHYRA 89 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +1 Query: 637 GTQFRPIVSRITIHWPSFYN 696 G RPIVSRITIHWP+FYN Sbjct: 37 GAPIRPIVSRITIHWPAFYN 56 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +1 Query: 637 GTQFRPIVSRITIHWPSFYN 696 G RPIVS ITIHWPSFYN Sbjct: 39 GAPIRPIVSHITIHWPSFYN 58 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 649 RPIVSRITIHWPSFYNV 699 RP+VSRITIHW SFYNV Sbjct: 34 RPVVSRITIHWTSFYNV 50 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = +1 Query: 58 IHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPG 162 I E + +I K D+D+R+ LY+N V+SGG+T++ G Sbjct: 257 IIEVLAFAIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 649 RPIVSRITIHWPSFY 693 RPIVSRITIHWPSFY Sbjct: 19 RPIVSRITIHWPSFY 33 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 699 DVVKRRPVNCNTTHYRA 649 D KRRPVNCNTTHYRA Sbjct: 80 DGEKRRPVNCNTTHYRA 96 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.1 bits (82), Expect = 0.014 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 652 PIVSRITIHWPSFYNV 699 P +SRITIHWPSFYNV Sbjct: 77 PYMSRITIHWPSFYNV 92 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 35 PYSESYYNSLAVVLQR 50 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 33 PYSESYYNSLAVVLQR 48 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 58 PYSESYYNSLAVVLQR 73 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 49 PYSESYYNSLAVVLQR 64 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 26 PYSESYYNSLAVVLQR 41 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 41 PYSESYYNSLAVVLQR 56 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 50 PYSESYYNSLAVVLQR 65 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 31 PYSESYYNSLAVVLQR 46 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 207 PYSESYYNSLAVVLQR 222 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 102 PYSESYYNSLAVVLQR 117 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 38 PYSESYYNSLAVVLQR 53 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 372 PYSESYYNSLAVVLQR 387 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 30 PYSESYYNSLAVVLQR 45 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 29 PYSESYYNSLAVVLQR 44 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 36 PYSESYYNSLAVVLQR 51 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 331 PYSESYYNSLAVVLQR 346 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 71 PYSESYYNSLAVVLQR 86 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 41 PYSESYYNSLAVVLQR 56 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 50 PYSESYYNSLAVVLQR 65 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 34 PYSESYYNSLAVVLQR 49 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 125 PYSESYYNSLAVVLQR 140 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 54 PYSESYYNSLAVVLQR 69 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 30 PYSESYYNSLAVVLQR 45 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 58 PYSESYYNSLAVVLQR 73 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 247 PYSESYYNSLAVVLQR 262 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 27 PYSESYYNSLAVVLQR 42 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 105 PYSESYYNSLAVVLQR 120 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 25 PYSESYYNSLAVVLQR 40 >SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 387 PYSESYYNSLAVVLQR 402 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 110 PYSESYYNSLAVVLQR 125 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 405 PYSESYYNSLAVVLQR 420 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 47 PYSESYYNSLAVVLQR 62 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 37 PYSESYYNSLAVVLQR 52 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 45 PYSESYYNSLAVVLQR 60 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 54 PYSESYYNSLAVVLQR 69 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 176 PYSESYYNSLAVVLQR 191 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 25 PYSESYYNSLAVVLQR 40 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 31 PYSESYYNSLAVVLQR 46 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 45 PYSESYYNSLAVVLQR 60 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 42 PYSESYYNSLAVVLQR 57 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 26 PYSESYYNSLAVVLQR 41 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 40 PYSESYYNSLAVVLQR 55 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 30 PYSESYYNSLAVVLQR 45 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 75 PYSESYYNSLAVVLQR 90 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 331 PYSESYYNSLAVVLQR 346 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 77 PYSESYYNSLAVVLQR 92 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 27 PYSESYYNSLAVVLQR 42 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 285 PYSESYYNSLAVVLQR 300 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 48 PYSESYYNSLAVVLQR 63 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 402 PYSESYYNSLAVVLQR 417 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 42 PYSESYYNSLAVVLQR 57 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 34 PYSESYYNSLAVVLQR 49 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 84 PYSESYYNSLAVVLQR 99 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 202 PYSESYYNSLAVVLQR 217 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 34 PYSESYYNSLAVVLQR 49 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 34 PYSESYYNSLAVVLQR 49 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 42 PYSESYYNSLAVVLQR 57 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 36 PYSESYYNSLAVVLQR 51 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 26 PYSESYYNSLAVVLQR 41 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 186 PYSESYYNSLAVVLQR 201 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 43 PYSESYYNSLAVVLQR 58 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 44 PYSESYYNSLAVVLQR 59 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 77 PYSESYYNSLAVVLQR 92 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 40 PYSESYYNSLAVVLQR 55 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 178 PYSESYYNSLAVVLQR 193 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 58 PYSESYYNSLAVVLQR 73 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 41 PYSESYYNSLAVVLQR 56 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 67 PYSESYYNSLAVVLQR 82 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 87 PYSESYYNSLAVVLQR 102 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 31 PYSESYYNSLAVVLQR 46 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 40 PYSESYYNSLAVVLQR 55 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 654 PYSESYYNSLAVVLQR 669 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 39 PYSESYYNSLAVVLQR 54 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 28 PYSESYYNSLAVVLQR 43 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 27 PYSESYYNSLAVVLQR 42 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 34 PYSESYYNSLAVVLQR 49 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 71 PYSESYYNSLAVVLQR 86 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 21 PYSESYYNSLAVVLQR 36 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 36 PYSESYYNSLAVVLQR 51 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 136 PYSESYYNSLAVVLQR 151 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 66 PYSESYYNSLAVVLQR 81 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 916 PYSESYYNSLAVVLQR 931 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 37 PYSESYYNSLAVVLQR 52 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 48 PYSESYYNSLAVVLQR 63 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 37 PYSESYYNSLAVVLQR 52 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 344 PYSESYYNSLAVVLQR 359 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 66 PYSESYYNSLAVVLQR 81 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 117 PYSESYYNSLAVVLQR 132 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 88 PYSESYYNSLAVVLQR 103 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 45 PYSESYYNSLAVVLQR 60 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 95 PYSESYYNSLAVVLQR 110 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 38 PYSESYYNSLAVVLQR 53 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 899 PYSESYYNSLAVVLQR 914 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 30 PYSESYYNSLAVVLQR 45 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 34 PYSESYYNSLAVVLQR 49 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 86 PYSESYYNSLAVVLQR 101 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 72 PYSESYYNSLAVVLQR 87 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 28 PYSESYYNSLAVVLQR 43 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 47 PYSESYYNSLAVVLQR 62 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 41 PYSESYYNSLAVVLQR 56 >SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 43 PYSESYYNSLAVVLQR 58 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 87 PYSESYYNSLAVVLQR 102 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 66 PYSESYYNSLAVVLQR 81 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 49 PYSESYYNSLAVVLQR 64 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 36.7 bits (81), Expect = 0.018 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +3 Query: 627 GGARYPIPPYSESYYNSLAVVLQR 698 GGA PI PYSESYY+SLAV LQR Sbjct: 51 GGA--PIRPYSESYYSSLAVGLQR 72 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 62 PYSESYYNSLAVVLQR 77 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 38 PYSESYYNSLAVVLQR 53 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 44 PYSESYYNSLAVVLQR 59 >SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 47 PYSESYYNSLAVVLQR 62 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 103 PYSESYYNSLAVVLQR 118 >SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 53 PYSESYYNSLAVVLQR 68 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 64 PYSESYYNSLAVVLQR 79 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 26 PYSESYYNSLAVVLQR 41 >SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 916 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 816 PYSESYYNSLAVVLQR 831 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 63 PYSESYYNSLAVVLQR 78 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 48 PYSESYYNSLAVVLQR 63 >SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) Length = 872 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 772 PYSESYYNSLAVVLQR 787 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 38 PYSESYYNSLAVVLQR 53 >SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) Length = 372 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 62 PYSESYYNSLAVVLQR 77 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 165 PYSESYYNSLAVVLQR 180 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 506 PYSESYYNSLAVVLQR 521 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 25 PYSESYYNSLAVVLQR 40 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 58 PYSESYYNSLAVVLQR 73 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 33 PYSESYYNSLAVVLQR 48 >SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 104 PYSESYYNSLAVVLQR 119 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 59 PYSESYYNSLAVVLQR 74 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 84 PYSESYYNSLAVVLQR 99 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 47 PYSESYYNSLAVVLQR 62 >SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) Length = 352 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 176 PYSESYYNSLAVVLQR 191 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 27 PYSESYYNSLAVVLQR 42 >SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 27 PYSESYYNSLAVVLQR 42 >SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 77 PYSESYYNSLAVVLQR 92 >SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 30 PYSESYYNSLAVVLQR 45 >SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 25 PYSESYYNSLAVVLQR 40 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 547 PYSESYYNSLAVVLQR 562 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 46 PYSESYYNSLAVVLQR 61 >SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 45 PYSESYYNSLAVVLQR 60 >SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 47 PYSESYYNSLAVVLQR 62 >SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 57 PYSESYYNSLAVVLQR 72 >SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 452 PYSESYYNSLAVVLQR 467 >SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 651 PYSESYYNSLAVVLQR 698 PYSESYYNSLAVVLQR Sbjct: 20 PYSESYYNSLAVVLQR 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,050,391 Number of Sequences: 59808 Number of extensions: 434455 Number of successful extensions: 4093 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4074 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -