BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31229 (602 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 27 0.12 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.49 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.1 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 27.1 bits (57), Expect = 0.12 Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = -3 Query: 255 VQIFGVYQDLLSSMTSGVISTRPVFVKLIHSIFSRLSLHCV---VKHEC 118 VQI + Q+++ G + F K++ I ++ S C+ V H+C Sbjct: 46 VQILALLQEIIPKSYFGTTTNLKRFYKVVEKILTQSSFECIHLSVLHKC 94 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.0 bits (52), Expect = 0.49 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 7 TTTSSRMNAKPVPASRNCLENETLKIPKSGFASED 111 T+TSS + KP + N L ET+ +P+ +D Sbjct: 431 TSTSSTNSNKPNSSDLNMLIKETMPLPRKLVRGQD 465 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 268 AYGGSWENGKLVLSWP 315 A G W+N K + WP Sbjct: 1308 APGLHWDNNKNICDWP 1323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,751 Number of Sequences: 336 Number of extensions: 2499 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -