BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31229 (602 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0638 - 5376164-5376247,5376734-5380517,5382029-5382045 27 8.7 05_07_0357 - 29533496-29533556,29533638-29533770,29533857-295339... 27 8.7 >12_01_0638 - 5376164-5376247,5376734-5380517,5382029-5382045 Length = 1294 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -2 Query: 373 ILDSFAAHC--SVAKPSRRLRLATTKL--AFHFPKIHHKPDLAGSNLWRLS 233 ++DS H +V + S+ LRL + L FH PKI H L +L R+S Sbjct: 617 LIDSNLFHAVENVMEQSKSLRLLQSNLENTFHLPKIAHLKHLCYIDLPRIS 667 >05_07_0357 - 29533496-29533556,29533638-29533770,29533857-29533953, 29534073-29534141,29534221-29534378,29534483-29534527, 29534598-29534625 Length = 196 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 277 GSWENGKLVLSWPVSDVLMVLQHYNGQQTNPKSRVHIQTFYP 402 G + ++VL P SD + +GQ+T K VH+ T +P Sbjct: 104 GKRKVAEIVLKTPSSDKKAKIATPSGQKTGDKKGVHVATPHP 145 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,166,339 Number of Sequences: 37544 Number of extensions: 260348 Number of successful extensions: 755 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -