BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31229 (602 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99571-1|CAI42723.1| 445|Homo sapiens spermidine/spermine N1-ac... 29 9.5 BC126401-1|AAI26402.1| 445|Homo sapiens spermidine/spermine N1-... 29 9.5 BC043215-1|AAH43215.2| 445|Homo sapiens spermidine/spermine N1-... 29 9.5 >Z99571-1|CAI42723.1| 445|Homo sapiens spermidine/spermine N1-acetyl transferase-like 1 protein. Length = 445 Score = 29.5 bits (63), Expect = 9.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +1 Query: 238 NAKDLNLPGPAYGGSWENGKLVLS-WPVSDVLMVLQHYNGQQTNPKSRVHIQT 393 N D+N PG G+W+ G+ WP S +VL + Q P R Q+ Sbjct: 120 NLPDINQPGMKQPGTWQLGRSQPGMWPQSLSELVLSEASISQPGPPQRAPSQS 172 >BC126401-1|AAI26402.1| 445|Homo sapiens spermidine/spermine N1-acetyl transferase-like 1 protein. Length = 445 Score = 29.5 bits (63), Expect = 9.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +1 Query: 238 NAKDLNLPGPAYGGSWENGKLVLS-WPVSDVLMVLQHYNGQQTNPKSRVHIQT 393 N D+N PG G+W+ G+ WP S +VL + Q P R Q+ Sbjct: 120 NLPDINQPGMKQPGTWQLGRSQPGMWPQSLSELVLSEASISQPGPPQRAPSQS 172 >BC043215-1|AAH43215.2| 445|Homo sapiens spermidine/spermine N1-acetyl transferase-like 1 protein. Length = 445 Score = 29.5 bits (63), Expect = 9.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +1 Query: 238 NAKDLNLPGPAYGGSWENGKLVLS-WPVSDVLMVLQHYNGQQTNPKSRVHIQT 393 N D+N PG G+W+ G+ WP S +VL + Q P R Q+ Sbjct: 120 NLPDINQPGMKQPGTWQLGRSQPGMWPQSLSELVLSEASISQPGPPQRAPSQS 172 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,467,796 Number of Sequences: 237096 Number of extensions: 1441876 Number of successful extensions: 2760 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2760 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6354183230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -