BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31228 (418 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|ch... 25 3.6 SPCC338.15 |||dolichyl-di-phosphooligosaccharide-protein glycotr... 25 3.6 SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 25 3.6 SPAC1639.01c ||SPAC806.09c|GNS1/SUR4 family protein|Schizosaccha... 25 6.2 >SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|chr 3|||Manual Length = 862 Score = 25.4 bits (53), Expect = 3.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 80 KTFINMNVDPERINITTCNFRVYDKVKY 163 K+ N N+DP+ + +T+ F +D V+Y Sbjct: 220 KSIFNFNMDPDALRLTSLGF--FDFVQY 245 >SPCC338.15 |||dolichyl-di-phosphooligosaccharide-protein glycotransferase subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 437 Score = 25.4 bits (53), Expect = 3.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 214 KFTFNLFLFFKSNFIRFL*SHYPF 285 K TF L FF + F RFL YP+ Sbjct: 379 KSTFTLRQFFHNEFPRFLPHAYPY 402 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 25.4 bits (53), Expect = 3.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 177 LLVIPYLTLS*TLKLHVVILILSGSTFMFIN 85 +LV PYL S L +L GS FM+IN Sbjct: 523 VLVAPYLYQSGAFMLIGFVLACFGSYFMYIN 553 >SPAC1639.01c ||SPAC806.09c|GNS1/SUR4 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 328 Score = 24.6 bits (51), Expect = 6.2 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +3 Query: 195 FQKRFSKIYL*SFF--IF*IKLYKIPLITLSFCF*LSFFIPFGDNFIAIITK 344 F++ IY FF I K + PL+ L +C +S F+ D F ++ K Sbjct: 87 FEQVAPAIYKHGFFFSICNEKAWTQPLVFLYYCAYISKFLELTDTFFLVLRK 138 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,351,629 Number of Sequences: 5004 Number of extensions: 23966 Number of successful extensions: 48 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 146319408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -