BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31228 (418 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-1321|AAF52544.2| 490|Drosophila melanogaster CG13793-P... 29 2.5 AE014296-2182|AAF49887.2| 3892|Drosophila melanogaster CG32113-P... 27 7.6 >AE014134-1321|AAF52544.2| 490|Drosophila melanogaster CG13793-PA protein. Length = 490 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 229 LFLFFKSNFIRFL*SHYPFVFNYHSLFLSETILLQSL 339 +F++ + F+ HY V N+ LFLS L SL Sbjct: 233 IFIYIMFGMVSFMLEHYFLVINHWVLFLSSASALSSL 269 >AE014296-2182|AAF49887.2| 3892|Drosophila melanogaster CG32113-PA protein. Length = 3892 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 287 TKG*CDQRNLIKFDLKNKKRLKVNFTKAFLE 195 TKG D + + + +K+ LK+N T F+E Sbjct: 2410 TKGHLDNKKRFEIGISSKQMLKLNVTSTFIE 2440 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,283,885 Number of Sequences: 53049 Number of extensions: 210335 Number of successful extensions: 430 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1251032760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -