BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31228 (418 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28739-12|AAB93454.1| 200|Caenorhabditis elegans Hypothetical p... 28 3.1 Z77662-5|CAB01192.2| 579|Caenorhabditis elegans Hypothetical pr... 27 7.2 >U28739-12|AAB93454.1| 200|Caenorhabditis elegans Hypothetical protein C17G10.7 protein. Length = 200 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = +1 Query: 229 LFLFFKSNFIRFL*SHYPFVFNYHSLFLSETILLQSLQNS 348 L +FF + F+ FL S Y ++N+ +FLS +LL+ + +S Sbjct: 53 LLMFFVNTFVVFL-SMYG-LYNFRPVFLSPNVLLKIILSS 90 >Z77662-5|CAB01192.2| 579|Caenorhabditis elegans Hypothetical protein F47B8.5 protein. Length = 579 Score = 26.6 bits (56), Expect = 7.2 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +1 Query: 223 FNLFLFFKSNFIRFL*SHYPFVFNYHSLFLSETILLQSL 339 F+LF FF NFI F SH+ F L ET+ Q + Sbjct: 316 FSLFSFF--NFITFSTSHFHFHNKIKFLLEGETVYKQKI 352 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,300,063 Number of Sequences: 27780 Number of extensions: 128410 Number of successful extensions: 348 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 348 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 683806592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -