BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31228 (418 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23240.2 68414.m02908 caleosin-related family protein similar... 29 1.7 At4g24020.1 68417.m03452 RWP-RK domain-containing protein simila... 26 8.9 >At1g23240.2 68414.m02908 caleosin-related family protein similar to caleosin GB:AAF13743 GI:6478218 from [Sesamum indicum]; similar to Ca+2-binding EF hand protein GB:AAB71227 [Glycine max]; contains Pfam profilePF05042: Caleosin related protein Length = 174 Score = 28.7 bits (61), Expect = 1.7 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 259 RFL*SHYPFVFNYHSLFLSETILLQSLQNSVK--REPADIQDVFIQSSIY 402 RF+ S + +FN H+ + + + +Q +K R+P DI F+ S ++ Sbjct: 122 RFVESKFEEIFNKHARTHKDALTAEEIQKMLKTNRDPFDITGWFVVSELF 171 >At4g24020.1 68417.m03452 RWP-RK domain-containing protein similar to nodule inception protein [Lotus japonicus] GI:6448579; contains Pfam profile: PF02042 RWP-RK domain Length = 959 Score = 26.2 bits (55), Expect = 8.9 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +1 Query: 241 FKSNFIRFL*SHYPFVFNYHSLFLSETILLQSLQNSVKREPADIQDVFIQSSI 399 F + +F + YP V +Y +F T SLQ+S + + I + F+ SSI Sbjct: 424 FCRDITKFCKTQYPLV-HYALMFKLTTCFAISLQSSYTGDDSYILEFFLPSSI 475 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,506,908 Number of Sequences: 28952 Number of extensions: 104832 Number of successful extensions: 193 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 635399168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -