BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31215 (457 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C4.03 |||haspin related kinase|Schizosaccharomyces pombe|c... 28 0.59 SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|... 27 1.8 SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosacchar... 26 2.4 >SPAC23C4.03 |||haspin related kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 488 Score = 28.3 bits (60), Expect = 0.59 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 258 RSRYNDLFRTLNPLKARNTSDASDSAVGYSDATTTLTSLPEIR 130 RSR +FR ++P+K A DS S T+ + L +R Sbjct: 443 RSRLKQIFRLIDPVKTMQFQQAEDSIRSKSTVTSATSLLNWVR 485 >SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 699 Score = 26.6 bits (56), Expect = 1.8 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 140 GNDVKVVVASLYPTALSDASEVFRALSGFKVRNRSLYRDRS 262 GN + VA +++ D ++VFR+L GFK RD S Sbjct: 97 GNIISASVAPQRISSVIDYADVFRSLPGFKNIENGGNRDTS 137 >SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1131 Score = 26.2 bits (55), Expect = 2.4 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = -2 Query: 321 KSSPDTPQPDTVRDTLAXXPDRSRYNDLFRTLNPLKARNTSDASDSAVGYSDATTTLTS 145 +S +T P V T++ S D T N + ++ S S YSD TTT+TS Sbjct: 660 QSLKETSSPAYVSSTVSYT---SSSVDSSSTYNSTGSSSSDSQSFSGTTYSDPTTTITS 715 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,549,780 Number of Sequences: 5004 Number of extensions: 26274 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 170285640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -