BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31215 (457 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42640.1 68418.m05191 zinc finger (C2H2 type) family protein ... 28 2.6 >At5g42640.1 68418.m05191 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 300 Score = 28.3 bits (60), Expect = 2.6 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = -2 Query: 261 DRSRYNDLFRTLNPLKARNTSDASDSAVGYSDATTTLTSLPEIRNSMARA 112 DR + DLF + + S S S+VG++++ T L +S++RA Sbjct: 41 DRMNHRDLFSSPPSFSSYQNSHISSSSVGFNNSHMTYHMLKRNYDSVSRA 90 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,789,562 Number of Sequences: 28952 Number of extensions: 128195 Number of successful extensions: 269 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 269 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 752336160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -