BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31211 (720 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011421-1|AAR96213.1| 156|Drosophila melanogaster AT02670p pro... 30 2.8 AE014297-1073|AAN13450.1| 156|Drosophila melanogaster CG31407-P... 30 2.8 AY095038-1|AAM11366.1| 819|Drosophila melanogaster LD28013p pro... 29 6.4 AE014297-4823|AAF57207.1| 1844|Drosophila melanogaster CG1976-PA... 29 6.4 >BT011421-1|AAR96213.1| 156|Drosophila melanogaster AT02670p protein. Length = 156 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -3 Query: 181 LKIAMGPGSPITVTITRHAKPRVNSNDNRNRQPTGRSSLD 62 LK+ GSP +T R+ PRV+S + R P+G SLD Sbjct: 108 LKLQQLDGSPPMMTGIRY--PRVSSGEQREHMPSGDVSLD 145 >AE014297-1073|AAN13450.1| 156|Drosophila melanogaster CG31407-PA protein. Length = 156 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -3 Query: 181 LKIAMGPGSPITVTITRHAKPRVNSNDNRNRQPTGRSSLD 62 LK+ GSP +T R+ PRV+S + R P+G SLD Sbjct: 108 LKLQQLDGSPPMMTGIRY--PRVSSGEQREHMPSGDVSLD 145 >AY095038-1|AAM11366.1| 819|Drosophila melanogaster LD28013p protein. Length = 819 Score = 29.1 bits (62), Expect = 6.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 153 PLPSPSHGTPNRGSIATTTGTGS 85 P P P GTP+ GS + +TG+GS Sbjct: 236 PSPLPLPGTPSPGSSSASTGSGS 258 >AE014297-4823|AAF57207.1| 1844|Drosophila melanogaster CG1976-PA protein. Length = 1844 Score = 29.1 bits (62), Expect = 6.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 153 PLPSPSHGTPNRGSIATTTGTGS 85 P P P GTP+ GS + +TG+GS Sbjct: 1261 PSPLPLPGTPSPGSSSASTGSGS 1283 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,043,281 Number of Sequences: 53049 Number of extensions: 676558 Number of successful extensions: 1914 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1912 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3211306956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -