BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31210 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 27 0.55 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 9.0 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 27.1 bits (57), Expect = 0.55 Identities = 13/51 (25%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -1 Query: 182 LFYYYYNKDCFRGLIKILLHKNEIVRIDESLRFEYVF-DRLATQSKMSIHD 33 ++ Y Y+K +G+++ LHK +D + F YV D++A ++ + +++ Sbjct: 1936 IWQYLYDK---QGILRFSLHKEHNETLDRVIHFTYVSDDKVAREALVHLNE 1983 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 682 FFFFLKKSVILFFNLIV 632 F +FL S+I FFNL++ Sbjct: 269 FVYFLPFSLISFFNLMI 285 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,634 Number of Sequences: 2352 Number of extensions: 10467 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -