BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31208 (509 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31320.1 68415.m03824 poly [ADP-ribose] polymerase, putative ... 105 1e-23 At4g02390.1 68417.m00323 poly (ADP-ribose) polymerase / NAD(+) A... 68 4e-12 At1g63870.1 68414.m07233 disease resistance protein (TIR-NBS-LRR... 31 0.45 At5g67540.2 68418.m08516 glycosyl hydrolase family protein 43 co... 30 1.0 At5g67540.1 68418.m08517 glycosyl hydrolase family protein 43 co... 30 1.0 At3g07110.1 68416.m00847 60S ribosomal protein L13A (RPL13aA) si... 30 1.0 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 29 1.4 At5g23650.1 68418.m02773 myb family transcription factor contain... 29 1.8 At3g60200.1 68416.m06726 expressed protein hypothetical proteins... 29 2.4 At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR... 29 2.4 At5g18410.2 68418.m02167 expressed protein similar to p53 induci... 28 3.2 At5g18410.1 68418.m02166 expressed protein similar to p53 induci... 28 3.2 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 28 3.2 At3g51540.1 68416.m05644 expressed protein mucin 5AC, Homo sapie... 27 5.5 At3g48190.1 68416.m05257 ataxia-telangiectasia mutated protein (... 27 5.5 At3g25230.1 68416.m03152 peptidyl-prolyl cis-trans isomerase / F... 27 5.5 At2g17525.1 68415.m02027 pentatricopeptide (PPR) repeat-containi... 27 5.5 At1g56540.1 68414.m06502 disease resistance protein (TIR-NBS-LRR... 27 7.3 At1g08440.1 68414.m00933 hypothetical protein contains Pfam prof... 27 7.3 At5g61790.1 68418.m07754 calnexin 1 (CNX1) identical to calnexin... 27 9.7 At4g20850.1 68417.m03025 subtilase family protein contains simil... 27 9.7 At3g47040.1 68416.m05108 glycosyl hydrolase family 3 protein bet... 27 9.7 At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ... 27 9.7 >At2g31320.1 68415.m03824 poly [ADP-ribose] polymerase, putative / NAD(+) ADP-ribosyltransferase, putative / poly[ADP-ribose] synthetase, putative similar to poly(ADP)-ribose polymerase [Zea mays] GI:3928871 ; contains Pfam profiles PF00644: Poly(ADP-ribose) polymerase catalytic domain, PF00645: Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region, PF02877: Poly(ADP-ribose) polymerase, regulatory domain, PF00533: BRCA1 C Terminus (BRCT) domain Length = 983 Score = 105 bits (253), Expect = 1e-23 Identities = 56/146 (38%), Positives = 88/146 (60%), Gaps = 4/146 (2%) Frame = +1 Query: 82 KSIPKSKSMYVKSEKSAVKLKIRDGNAVDPASELDEECHVYTDRYKTTYSVVLSLADVVA 261 + +P K + +S V +K++ +AV AS L E CH+ D + Y+ LS++D+ Sbjct: 475 RKLPFDKYKIEDTSESLVTVKVKGRSAVHEASGLQEHCHILEDG-NSIYNTTLSMSDLST 533 Query: 262 QKNSFYKLQILKHNKENRYWLFRSWGRIGT-TIGGSKVEKMKDLDNALDRFQALYEEKTE 438 NS+Y LQI++ +K + ++FR WGR+G IGG+KVE+M D A+ F+ L+ EKT Sbjct: 534 GINSYYILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKVEEMSKSD-AVHEFKRLFLEKTG 592 Query: 439 N---RWKDRNNFVKIAGRYFPLEIDY 507 N W+ + NF K G++ PL+IDY Sbjct: 593 NTWESWEQKTNFQKQPGKFLPLDIDY 618 >At4g02390.1 68417.m00323 poly (ADP-ribose) polymerase / NAD(+) ADP-ribosyltransferase / poly[ADP-ribose] synthetase (APP) identical to SP|Q11207 Poly [ADP-ribose] polymerase (EC 2.4.2.30) (PARP) (ADPRT) (NAD(+) ADP- ribosyltransferase) (Poly[ADP-ribose] synthetase) {Arabidopsis thaliana} Length = 637 Score = 67.7 bits (158), Expect = 4e-12 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 1/111 (0%) Frame = +1 Query: 178 ELDEECHVYTDRYKTTYSVVLSLADVVAQKNSFYKLQILKHNKENRYWLFRSWGRIGTTI 357 E+ + HV R Y +L+ +V N F+ LQ+L+ + + Y ++ WGR+G Sbjct: 154 EIKSQYHVL-QRGDDVYDAILNQTNVRDNNNKFFVLQVLESDSKKTYMVYTRWGRVGVK- 211 Query: 358 GGSKVEKMKD-LDNALDRFQALYEEKTENRWKDRNNFVKIAGRYFPLEIDY 507 G SK++ D D A++ F + +KT+N W DR F+ Y LE+DY Sbjct: 212 GQSKLDGPYDSWDRAIEIFTNKFNDKTKNYWSDRKEFIPHPKSYTWLEMDY 262 >At1g63870.1 68414.m07233 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1031 Score = 31.1 bits (67), Expect = 0.45 Identities = 18/66 (27%), Positives = 28/66 (42%) Frame = -3 Query: 414 LESVQSVIEIFHLLDFTAADRCADPTPRTEQPVSVLFIMFQDLQFVERVLLSDNISEREH 235 +E++ I+ HLL C E P S+ F+M D + +E V N + E Sbjct: 771 IETIPECIKSLHLLYILNLSGCRRLASLPELPSSLRFLMADDCESLETVFCPLNTPKAEL 830 Query: 234 DRVRCF 217 + CF Sbjct: 831 NFTNCF 836 >At5g67540.2 68418.m08516 glycosyl hydrolase family protein 43 contains similarity to xylanase GI:2645416 from [Caldicellulosiruptor saccharolyticus] Length = 471 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +1 Query: 331 SWGRIGTTIGGSKVEKMKDL--DNALDRFQALYEEKTE 438 +W G +G + K DL N L+R + +Y EKTE Sbjct: 211 TWKNEGIVLGAEETNKTHDLHKSNVLERPKVIYNEKTE 248 >At5g67540.1 68418.m08517 glycosyl hydrolase family protein 43 contains similarity to xylanase GI:2645416 from [Caldicellulosiruptor saccharolyticus] Length = 466 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +1 Query: 331 SWGRIGTTIGGSKVEKMKDL--DNALDRFQALYEEKTE 438 +W G +G + K DL N L+R + +Y EKTE Sbjct: 206 TWKNEGIVLGAEETNKTHDLHKSNVLERPKVIYNEKTE 243 >At3g07110.1 68416.m00847 60S ribosomal protein L13A (RPL13aA) similar to ribosomal protein L13A GB:O49885 [Lupinus luteus] Length = 206 Score = 29.9 bits (64), Expect = 1.0 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +1 Query: 283 LQILKHNKENRYWLFRSWGRIGTTIGGSKVEKMKDLDN-ALDRFQALYEEKTE 438 L++L+ ++Y L GR+ + +G + + +K+L+N +R QA+YE K + Sbjct: 129 LKVLRLQAGHKYCLL---GRLSSEVGWNHYDTIKELENKRKERAQAVYERKKQ 178 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 29.5 bits (63), Expect = 1.4 Identities = 26/133 (19%), Positives = 54/133 (40%), Gaps = 1/133 (0%) Frame = +1 Query: 61 PQDIIDGKSIPKSKSMYVKSEKSAVK-LKIRDGNAVDPASELDEECHVYTDRYKTTYSVV 237 P +I++ K++P + E++ V+ + + +DP +V +KTT + Sbjct: 526 PGNILEPKNLPDTNEERSDIEENGVRRVNLEQQVEIDPDVTESNVLNVKNLSFKTTDEGL 585 Query: 238 LSLADVVAQKNSFYKLQILKHNKENRYWLFRSWGRIGTTIGGSKVEKMKDLDNALDRFQA 417 + ++ + I+KH K +Y L +G + + +DL + A Sbjct: 586 KKHFTKLVKQGKILSVTIIKHKKNEKY-LSSGYGFVEFDSVETATSVYRDLQGTVLDGHA 644 Query: 418 LYEEKTENRWKDR 456 L EN+ D+ Sbjct: 645 LILRFCENKRSDK 657 >At5g23650.1 68418.m02773 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 337 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 382 KDLDNALDRFQALYEEKTENRWK 450 KD D A ++ A+Y +KTE RWK Sbjct: 15 KDDDIAFEKALAIYNDKTEIRWK 37 >At3g60200.1 68416.m06726 expressed protein hypothetical proteins At2g44600 - Arabidopsis thaliana, EMBL:AAC27462 Length = 305 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/66 (22%), Positives = 30/66 (45%) Frame = +2 Query: 176 RNWTRSATCTRTATKQRTRSCSRSLMLSLKRTLSTNCRS*NIIKRTDTGCSVRGVGSAQR 355 R+W + T KQ T +C +++ +R CR + ++ T+ S + +R Sbjct: 158 RSWISTILSTGRRKKQPTTACYIEDVIAARRPQRIYCRGMSPVRDTEPEQSAESIEELRR 217 Query: 356 SAAVKS 373 + A K+ Sbjct: 218 TPATKT 223 >At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 897 Score = 28.7 bits (61), Expect = 2.4 Identities = 20/78 (25%), Positives = 33/78 (42%) Frame = -3 Query: 414 LESVQSVIEIFHLLDFTAADRCADPTPRTEQPVSVLFIMFQDLQFVERVLLSDNISEREH 235 +E V I+ H L + C E P S+ + +D +ERV S NI + Sbjct: 773 IEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQF 832 Query: 234 DRVRCFVAVRVHVALLVQ 181 + ++CF R ++Q Sbjct: 833 NFIKCFTLDREARRAIIQ 850 >At5g18410.2 68418.m02167 expressed protein similar to p53 inducible protein [Homo sapiens] GI:5616320 Length = 1017 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 461 LFLSFQRFSVFSSYSAWNLSKALSRSFIFS 372 +F+S S+F+ Y +W+ S+ L SF+F+ Sbjct: 698 IFVSRLSESIFTYYKSWSASELLDPSFLFA 727 >At5g18410.1 68418.m02166 expressed protein similar to p53 inducible protein [Homo sapiens] GI:5616320 Length = 1234 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 461 LFLSFQRFSVFSSYSAWNLSKALSRSFIFS 372 +F+S S+F+ Y +W+ S+ L SF+F+ Sbjct: 698 IFVSRLSESIFTYYKSWSASELLDPSFLFA 727 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +1 Query: 52 SKLPQDI-IDGKSIPKSKSMYVKSEKSAVKLKIRDGNAVDPASELDEE 192 S +P+ + I ++PK +S S K VK G+ DP+++ +E+ Sbjct: 775 SDVPEHVAIPETTVPKEESTGTSSNKKIVKKVAETGDTSDPSAKANEQ 822 >At3g51540.1 68416.m05644 expressed protein mucin 5AC, Homo sapiens, PIR:S53363 Length = 438 Score = 27.5 bits (58), Expect = 5.5 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 230 RSCSRSLMLSLKRTLSTNCRS*NIIKRTDTGCSVRGVGSAQRSAAVKSR 376 R+ SRSL S ++T S I T T S + G AQRS ++ R Sbjct: 153 RTVSRSLTPSSRKTPSPTSTPSRISTTTSTTPSFKTAGDAQRSRSLTPR 201 >At3g48190.1 68416.m05257 ataxia-telangiectasia mutated protein (Atm) identical to ataxia-telangiectasia mutated protein (Atm) [Arabidopsis thaliana] GI:7529272; contains Pfam profile PF00855: PWWP domain; contains GA donor splice site at exon 73 Length = 3255 Score = 27.5 bits (58), Expect = 5.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 355 IGGSKVEKMKDLDNALDRFQALYEEKTENRWKDRNNFV 468 +G S + L+N L F +YEE TE+ W ++ V Sbjct: 1595 LGASYDFVIHSLENLLRSFAKVYEEYTEHAWNTHSDTV 1632 >At3g25230.1 68416.m03152 peptidyl-prolyl cis-trans isomerase / FK506-binding protein (ROF1) identical to rotamase FKBP (ROF1) GB:U49453 [Arabidopsis thaliana] (Mol. Gen. Genet. 252 (5), 510-517 (1996)) Length = 551 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +1 Query: 361 GSKVEKMKDLDNALDRFQALYEEKTENRWKDRNNFVKIAGRYFP 492 G K E KDLD L +F+A E+ T D F G + P Sbjct: 164 GEKWENPKDLDEVLVKFEAKLEDGTVVGKSDGVEFTVKDGHFCP 207 >At2g17525.1 68415.m02027 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat; gene structure supported by cDNA sequence and Brassica genome sequence alignments. Length = 626 Score = 27.5 bits (58), Expect = 5.5 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 6/59 (10%) Frame = +1 Query: 346 GTTIGGSKV-EKMKDLDNA----LDRFQA-LYEEKTENRWKDRNNFVKIAGRYFPLEID 504 G T G K+ E M+D D +D + +Y ENRW+D F+ + FP +D Sbjct: 402 GRTDDGLKILEMMQDSDTVHGARIDPYNCVIYGFYKENRWEDALEFLLKMEKLFPRAVD 460 >At1g56540.1 68414.m06502 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1096 Score = 27.1 bits (57), Expect = 7.3 Identities = 21/88 (23%), Positives = 35/88 (39%), Gaps = 2/88 (2%) Frame = -3 Query: 474 NLDKVIPVFPTVLSFFFVQR--LESVQSVIEIFHLLDFTAADRCADPTPRTEQPVSVLFI 301 NL + PT ++ + +ES+ I+ H L A C T + P S+ ++ Sbjct: 752 NLKTFSTLLPTSVTELHIDNSGIESITDCIKGLHNLRVLALSNCKKLTSLPKLPSSLKWL 811 Query: 300 MFQDLQFVERVLLSDNISEREHDRVRCF 217 + +ERV N + D CF Sbjct: 812 RASHCESLERVSEPLNTPNADLDFSNCF 839 >At1g08440.1 68414.m00933 hypothetical protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 501 Score = 27.1 bits (57), Expect = 7.3 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 133 VKLKIRDGNAVDPASELDEECHVYTDRYKTTYSVVLSLADVVAQKN 270 V +KI D +++ +E D + HV+T+R ++ L D +KN Sbjct: 457 VTIKINDDDSIHDKNE-DGDIHVHTNRVSCDHTNASDLLDSGVKKN 501 >At5g61790.1 68418.m07754 calnexin 1 (CNX1) identical to calnexin homolog 1, Arabidopsis thaliana, EMBL:AT08315 [SP|P29402] Length = 530 Score = 26.6 bits (56), Expect = 9.7 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 43 DPASKLPQDIIDGKSIPKSKSMYVKSEKSAVKLKIRDGNAVDPASELDEE 192 DP K P+D + IP ++ + ++I D A P LD+E Sbjct: 225 DPEDKKPEDWDERAKIPDPNAVKPEDWDEDAPMEIEDEEAEKPEGWLDDE 274 >At4g20850.1 68417.m03025 subtilase family protein contains similarity to Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) (Swiss-Prot:P29144) [Homo sapiens] Length = 1380 Score = 26.6 bits (56), Expect = 9.7 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 224 RTRSCSRSLMLSLKRT--LSTNCRS*NIIKRTDTGCSVRGVGSA 349 R RSCSRS + L+R+ + C S + + + GC G G A Sbjct: 49 RRRSCSRSRGIRLRRSGFSAMPCSSSDTLTASRVGCGGGGGGGA 92 >At3g47040.1 68416.m05108 glycosyl hydrolase family 3 protein beta-D-glucan exohydrolase, Nicotiana tabacum, TREMBL:AB017502_1 Length = 636 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 Query: 437 SVFSSYSAWNLSKALSRSFIFSTLL 363 +V +SYS+WN SK S F+ + LL Sbjct: 278 TVMASYSSWNGSKLHSDYFLLTELL 302 >At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to (SP:O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus]; similar to GI:298096 from [Homo sapiens] Length = 926 Score = 26.6 bits (56), Expect = 9.7 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -1 Query: 170 GSTALPSRILSLTADFSDLTYMLLLLGIDFPSIISWGSLEAGS 42 G A SR+ + +F+ + Y LLL I++ +++ G L+ S Sbjct: 566 GYLASQSRVFLVDKEFNVIGYTLLLSLIEYKTLVMRGDLDKAS 608 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.134 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,201,008 Number of Sequences: 28952 Number of extensions: 186667 Number of successful extensions: 699 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -