BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31207 (374 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosacchar... 29 0.18 SPAC23C4.03 |||haspin related kinase|Schizosaccharomyces pombe|c... 28 0.42 SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|... 27 0.73 >SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1131 Score = 29.5 bits (63), Expect = 0.18 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = -3 Query: 336 KSSPDTPQPDTVRDTLAYXPDRSRYNDLFRTLNPLKARNTSDASDSAVGYSDATTTLTS 160 +S +T P V T++Y S D T N + ++ S S YSD TTT+TS Sbjct: 660 QSLKETSSPAYVSSTVSYT---SSSVDSSSTYNSTGSSSSDSQSFSGTTYSDPTTTITS 715 >SPAC23C4.03 |||haspin related kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 488 Score = 28.3 bits (60), Expect = 0.42 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 273 RSRYNDLFRTLNPLKARNTSDASDSAVGYSDATTTLTSLPEIR 145 RSR +FR ++P+K A DS S T+ + L +R Sbjct: 443 RSRLKQIFRLIDPVKTMQFQQAEDSIRSKSTVTSATSLLNWVR 485 >SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 699 Score = 27.5 bits (58), Expect = 0.73 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 155 GNDVKVVVASLYPTALSDASEVFRALSGFKVRNRSLYRDRSGXYANVS 298 GN + VA +++ D ++VFR+L GFK RD S +S Sbjct: 97 GNIISASVAPQRISSVIDYADVFRSLPGFKNIENGGNRDTSSRIEELS 144 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,333,034 Number of Sequences: 5004 Number of extensions: 21950 Number of successful extensions: 61 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 120195862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -