BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31207 (374 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 25 0.29 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 1.6 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 25.0 bits (52), Expect = 0.29 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Frame = +2 Query: 134 CHRFLISGNDVKVVVASLYPTALSDASEVFRALSG--FKVRNRSLYRDRSGXYANVSRTV 307 C + +I+G V A YP A+ V A+ F + +R ++R Y N+ T Sbjct: 312 CVQAMIAGIVVISAGADAYPPL---AAIVLGAIGSIVFYIISRYVFRSALEDYCNIVATH 368 Query: 308 SGCGVSGELFWSF 346 CG+ G + F Sbjct: 369 LVCGILGSILVPF 381 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.6 bits (46), Expect = 1.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 336 KSSPDTPQPDTVRDTLAYXP 277 KS TP+PD + + L + P Sbjct: 326 KSPYHTPEPDCIHELLGHMP 345 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,971 Number of Sequences: 438 Number of extensions: 1670 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9052365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -