BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31206 (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0174 + 28156399-28156525,28157094-28157155,28157428-28158615 34 0.12 03_05_0211 - 22020515-22020687,22020801-22020831,22022060-220221... 34 0.12 08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164,310... 33 0.22 05_07_0230 - 28540114-28540323,28540414-28540548,28540779-285409... 31 0.66 04_04_1098 + 30876785-30876835,30876846-30877171,30877396-308774... 31 0.66 03_06_0285 + 32848085-32848988,32849057-32849245,32850136-328503... 31 0.66 03_02_0025 + 5084003-5084303,5084449-5084639,5084793-5084873,508... 28 0.66 01_06_1656 + 38946922-38947542,38947640-38947739,38948045-389481... 26 1.1 08_01_0397 - 3509186-3510291,3510322-3512335 30 1.5 02_05_0717 + 31190626-31191234,31191954-31192394,31192699-311928... 30 2.0 07_01_0463 + 3502708-3503535 29 2.6 10_08_0425 - 17806117-17806401,17806862-17806984,17807076-178072... 29 3.5 09_04_0512 + 18226981-18227143,18227648-18229555,18229649-182302... 29 3.5 03_05_0158 + 21348534-21348851 29 3.5 01_06_0213 + 27580635-27581105,27581206-27581298,27581376-275815... 29 3.5 10_01_0164 + 1863890-1866253 29 4.6 11_01_0442 - 3369827-3370168,3370608-3372616,3372953-3373277,337... 28 6.1 07_03_0363 + 17225472-17226778,17226910-17226917,17227313-172274... 28 6.1 02_05_0484 - 29401195-29401404,29401572-29401755,29401866-294039... 28 6.1 01_05_0166 + 18844468-18845184,18847394-18847690 28 6.1 08_02_1091 + 24256025-24256190,24256806-24257978,24258066-242587... 28 8.1 07_03_0537 - 19218461-19218982,19219482-19219868,19219993-192201... 28 8.1 03_04_0098 - 17275045-17275665 28 8.1 >05_07_0174 + 28156399-28156525,28157094-28157155,28157428-28158615 Length = 458 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = -1 Query: 155 RSRSLSHSALVLGPAAQRRW---NVEPRRPSCRIPAARGTTSIER 30 R RS+ GP RW N EP+RPS +IP A+ ++R Sbjct: 22 RRRSIWERGKAWGPCVGPRWRAPNAEPKRPSSQIPTAQPDPMVDR 66 >03_05_0211 - 22020515-22020687,22020801-22020831,22022060-22022169, 22022715-22023102,22023344-22023397,22023739-22023849, 22023956-22024015,22024618-22024694,22026155-22026188, 22026267-22027235 Length = 668 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Frame = +2 Query: 260 KQEGEGDPEFIKRQDQKRSDLDEQLKEY----INEWRKQRAKEEDELKRLIEKQAKRKVS 427 K+ G E +K QD+ S+ E+LKE + E+ +++A+EE ++ E++A+ K S Sbjct: 144 KESGSEKQEELKEQDKSGSEKQEELKEQDKSGLAEYEEKKAEEESGAEKQGEEEAEEKGS 203 >08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164, 3109210-3110952 Length = 947 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/48 (37%), Positives = 30/48 (62%) Frame = +2 Query: 278 DPEFIKRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAKRK 421 D E +R+ QK + +++ + E R++R KE E KRL E++AKR+ Sbjct: 11 DEEESERRRQKMIEEEKKRLDEEMELRRRRVKEWQEQKRLEEEEAKRR 58 Score = 31.1 bits (67), Expect = 0.87 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +2 Query: 260 KQEGEGDPEFIKRQDQKRSDLDEQLKEY-INEWRKQRAKEEDELKRLIEKQA 412 ++E E + + +++KR D + +L+ + EW++Q+ EE+E KR ++ A Sbjct: 12 EEESERRRQKMIEEEKKRLDEEMELRRRRVKEWQEQKRLEEEEAKRREQEAA 63 >05_07_0230 - 28540114-28540323,28540414-28540548,28540779-28540953, 28541104-28541300,28541824-28541945,28542887-28543193 Length = 381 Score = 31.5 bits (68), Expect = 0.66 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +2 Query: 263 QEGEGDPEFIKRQDQKRSDLDEQLKEYINE-WRKQRAKEE 379 +EG GD F++ LDEQL+ +++ W ++ KEE Sbjct: 2 KEGGGDGGFVRADQIDLKSLDEQLERHLSRAWTMEKRKEE 41 >04_04_1098 + 30876785-30876835,30876846-30877171,30877396-30877418, 30877687-30879392 Length = 701 Score = 31.5 bits (68), Expect = 0.66 Identities = 15/44 (34%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +2 Query: 293 KRQDQKRSDLDEQ-LKEYINEWRKQRAKEEDELKRLIEKQAKRK 421 + QD+KR +L++Q +E E +Q+ +EE+ + +EKQ +R+ Sbjct: 637 RSQDEKRKELEKQKQEEERKELDRQKQREEERKAKELEKQKQRE 680 >03_06_0285 + 32848085-32848988,32849057-32849245,32850136-32850311, 32850569-32851141 Length = 613 Score = 31.5 bits (68), Expect = 0.66 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 518 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFPSKRRAKTS 640 +E+ R+RLEE EK + +A +S G + P+ +R + S Sbjct: 452 LEDLRERLEELEKAKTEKKKAASSSSSGGSSGPANKRIRAS 492 >03_02_0025 + 5084003-5084303,5084449-5084639,5084793-5084873, 5084972-5085319,5085409-5086293 Length = 601 Score = 28.3 bits (60), Expect(2) = 0.66 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 293 KRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAKRK 421 K ++++ + KE E R+QR KEE+E +R E++ +R+ Sbjct: 467 KAEEEEEGGGGKGEKEREEEERRQREKEEEERRRQEEERKRRE 509 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/54 (25%), Positives = 33/54 (61%) Frame = +2 Query: 260 KQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAKRK 421 K+ E + ++++++R +E+ K E +++R +EE+E +R EK+ K++ Sbjct: 481 KEREEEERRQREKEEEERRRQEEERKRREEEEKERREREEEE-RRQREKEEKKR 533 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = +2 Query: 260 KQEGEGDPEFIKRQDQKRSDLDEQLKEYIN---EWRKQRAKEEDELKRLIEKQAKRK 421 +++ E + E +RQ+++R +E+ KE E R+QR KEE KR E++ +R+ Sbjct: 488 RRQREKEEEERRRQEEERKRREEEEKERREREEEERRQREKEEK--KRREEEEQRRE 542 Score = 21.8 bits (44), Expect(2) = 0.66 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +2 Query: 521 EEKRQRLEEAEKKRQ 565 EE+RQR +E +K+R+ Sbjct: 521 EERRQREKEEKKRRE 535 >01_06_1656 + 38946922-38947542,38947640-38947739,38948045-38948189, 38948868-38948991,38949443-38949960,38950111-38950458, 38950557-38950638,38951309-38951707,38951790-38951927, 38952063-38952108,38952200-38952369 Length = 896 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 293 KRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQ 409 K + + R +Q +E + E +K+R KEE E+K+ KQ Sbjct: 350 KEEARMRKQQKKQQEEALRE-QKRREKEEAEMKKQQRKQ 387 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 521 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFPSKRRAKTSV 643 E+KR+ EEAE ++Q Q ++A K KRR K +V Sbjct: 394 EQKRREKEEAETRKQQKKQ-QEEAEK-----EQKRREKEAV 428 >08_01_0397 - 3509186-3510291,3510322-3512335 Length = 1039 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/54 (31%), Positives = 33/54 (61%) Frame = +2 Query: 260 KQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAKRK 421 ++E D E +R+ QK+ + +++ + E R++R KE E+KR E++ KR+ Sbjct: 144 REEEVVDVEEAERRRQKKKEEEQKQLDEEMETRRRRIKEWQEMKRR-EEETKRR 196 >02_05_0717 + 31190626-31191234,31191954-31192394,31192699-31192802, 31193000-31194384,31194508-31194548,31195065-31195133, 31195335-31195435,31195747-31195825,31195939-31196037, 31196119-31196187,31197609-31197658,31197749-31197925, 31198045-31198152,31198224-31198290 Length = 1132 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 4/63 (6%) Frame = +2 Query: 248 TPAPKQEGEGDPEFIK----RQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAK 415 TP+ E EG P +++++S E+ + EW ++R++EE+ ++ + Q + Sbjct: 68 TPSTPSEAEGSPFSSSVGSGAEERRQSVAAERRRSQEEEWERRRSQEEEAVREMRRSQEE 127 Query: 416 RKV 424 +V Sbjct: 128 DEV 130 >07_01_0463 + 3502708-3503535 Length = 275 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/54 (33%), Positives = 32/54 (59%) Frame = +2 Query: 260 KQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAKRK 421 K++ +GD E K++++K+ D D KE E +K + +E+E + EK+ K K Sbjct: 124 KKKKDGDEEEGKKKEKKK-DKDGDEKEGKKEKKKDKDGDEEEEGKKKEKKKKDK 176 >10_08_0425 - 17806117-17806401,17806862-17806984,17807076-17807222, 17807307-17807450,17808557-17808668,17808762-17808898, 17809016-17809156,17810921-17811004,17811275-17811742, 17811858-17811936,17812494-17812506,17813884-17814460, 17814502-17814774,17814899-17815045,17815354-17815413, 17816124-17816510 Length = 1058 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = +2 Query: 311 RSDLDEQ--LKEYINEWRKQRAKEEDELKRLIEKQAKRK 421 ++ LDEQ LKE E RK++ +EE E++R ++ + +RK Sbjct: 868 KAKLDEQAKLKEREREMRKRKEREEQEMER-VKLKIRRK 905 >09_04_0512 + 18226981-18227143,18227648-18229555,18229649-18230295, 18230710-18231949,18232085-18232419,18232500-18232577, 18232872-18232978,18233020-18233062 Length = 1506 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/46 (28%), Positives = 30/46 (65%) Frame = +2 Query: 284 EFIKRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAKRK 421 E KR ++K+ + + ++++ + ++R K+E ELK+ E+Q K++ Sbjct: 1333 EAAKRLEEKKQN-EREMRKAAAKLERERLKQEKELKQKQEEQKKKR 1377 >03_05_0158 + 21348534-21348851 Length = 105 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -2 Query: 112 QHSDVGMWSRGDPRAEFLQPGGPLV*SGRHRGEXQS 5 QH+D G W D +L P GR RG S Sbjct: 32 QHADAGSWRHADAGRRYLARPDPSCGGGRQRGAPDS 67 >01_06_0213 + 27580635-27581105,27581206-27581298,27581376-27581540, 27581640-27581862,27582329-27582429,27582666-27582713, 27583086-27583172,27583745-27583879,27583985-27584140, 27585336-27585545,27585641-27586351,27586429-27586974, 27587872-27588495,27588595-27588699,27590460-27590711, 27590939-27591766 Length = 1584 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/43 (25%), Positives = 27/43 (62%) Frame = +2 Query: 290 IKRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAKR 418 +++QD + +EQ+++ + ++R KEE+ L R +++ +R Sbjct: 179 LEKQDMMKRKREEQMRKEMERHDRERRKEEERLLRERQREQER 221 >10_01_0164 + 1863890-1866253 Length = 787 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 305 QKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEK 406 +++ DE L+ + EW + K E++L R++EK Sbjct: 49 EEKVSRDEALRLLLEEWMDAKRKLEEKLNRVLEK 82 >11_01_0442 - 3369827-3370168,3370608-3372616,3372953-3373277, 3373386-3373415 Length = 901 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/38 (26%), Positives = 25/38 (65%) Frame = +2 Query: 302 DQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAK 415 D + + LD+ LKE + + R+ R ++E++++ + K+ + Sbjct: 145 DDQVNHLDDALKECVRQLRQAREEQEEKIRDAVAKKTQ 182 >07_03_0363 + 17225472-17226778,17226910-17226917,17227313-17227488, 17227822-17227882,17227955-17228053,17228155-17228249, 17228411-17228482,17228668-17228735,17228934-17229390, 17229486-17229596 Length = 817 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 515 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFPSKRR 628 DIE+ ++ L ++KR A + AS+ P F S+ R Sbjct: 395 DIEKDKEALGSVQRKRMARSRGGSQASQREPRFRSRMR 432 >02_05_0484 - 29401195-29401404,29401572-29401755,29401866-29403973, 29404320-29404403,29404507-29404777,29404864-29405117, 29405513-29405722,29406357-29406503 Length = 1155 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/50 (30%), Positives = 31/50 (62%) Frame = +2 Query: 260 KQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQ 409 KQ + + E+ ++ D+KR+ L+E+ K+ NE + ++E KRL +++ Sbjct: 503 KQRQKFEEEW-EQLDEKRTHLEEEAKKLNNEKKNLERWHDNEEKRLKDRE 551 >01_05_0166 + 18844468-18845184,18847394-18847690 Length = 337 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +2 Query: 515 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFPSKRRAKTSV*AMPSWSATRP 676 ++E +R+ EE E++R+ + +DA KRRA S A P S++ P Sbjct: 92 ELERRRREEEERERERELREREGRDALNISGEEAWKRRAAMSGSAAPRPSSSPP 145 >08_02_1091 + 24256025-24256190,24256806-24257978,24258066-24258733, 24258994-24260065,24260241-24260563,24260647-24260835, 24261400-24261506,24262103-24262163,24262617-24262634 Length = 1258 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/46 (28%), Positives = 31/46 (67%) Frame = +2 Query: 284 EFIKRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKRLIEKQAKRK 421 E +KR++QK+ + + ++++ E ++R K+E E ++L + + K+K Sbjct: 1040 EAVKRREQKKQN-EREMRKAAAELERERVKQERE-QKLKQMEQKKK 1083 >07_03_0537 - 19218461-19218982,19219482-19219868,19219993-19220154, 19220464-19221117,19221233-19221277,19223300-19223845, 19223930-19224307,19224642-19225313,19225373-19225456 Length = 1149 Score = 27.9 bits (59), Expect = 8.1 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +2 Query: 293 KRQDQKRSDLDEQLKEYINEWRKQRAKEEDE 385 +R D+++ +E+ +E +WR++R +EE++ Sbjct: 1077 ERSDEQQQQDEEEEEEEEQKWRRRRRREEED 1107 >03_04_0098 - 17275045-17275665 Length = 206 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 167 CRTGRSRSLSHSALVLGPAAQRRW--NVEPRRPS 72 C R R+L HS + RRW N+ PRR S Sbjct: 60 CTLSRHRNLGHSRAGAPGYSSRRWPTNIRPRRSS 93 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,210,446 Number of Sequences: 37544 Number of extensions: 310099 Number of successful extensions: 1398 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1393 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -