BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31201 (390 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 26 0.42 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 26 0.56 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 25 0.98 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 23 5.2 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 22 6.9 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 22 6.9 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 22 9.1 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 22 9.1 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 22 9.1 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 22 9.1 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 26.2 bits (55), Expect = 0.42 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 258 LDPVLL-EVPEEPTSEPRQDLIKYLGDAYK 344 L P+ L E+PEEP EP ++ + D+YK Sbjct: 1035 LKPLKLHEIPEEPPQEPLKEYTEEELDSYK 1064 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 25.8 bits (54), Expect = 0.56 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 92 VYSTVSPFGYKPGRYVADPSRYDPSRDN 175 V+ ++ Y P R+ DP R+DP R N Sbjct: 427 VFIPIAGLHYDP-RFYPDPDRFDPERFN 453 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 25.0 bits (52), Expect = 0.98 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +2 Query: 131 RYVADPSRYDPSRDN 175 RY ++P R++PSR+N Sbjct: 72 RYWSEPKRFNPSREN 86 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 22.6 bits (46), Expect = 5.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 Query: 122 KPGRYVADPSRYDPSRDN 175 + RY +P ++DP R N Sbjct: 108 REARYFPEPEKFDPERFN 125 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 22.2 bits (45), Expect = 6.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 65 RYTPFQYNRVYSTVSPFGYKPGRYVADPSRYDPSR 169 R+T + V+ V + P +Y +P R+DP R Sbjct: 41 RFTIEKGTLVFIPVVGIHFDP-KYFPEPERFDPER 74 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 22.2 bits (45), Expect = 6.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 131 RYVADPSRYDPSR 169 +Y DP R+DP R Sbjct: 416 QYYPDPERFDPER 428 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 144 NNTPIFFIRDPVLFP 158 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 319 SNTLVMLTRDPPLFP 363 +NT + RDP LFP Sbjct: 128 NNTPIFFIRDPVLFP 142 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 21.8 bits (44), Expect = 9.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 164 SRDNCWPLHLPDN 202 +R N WPL P+N Sbjct: 57 ARSNTWPLPRPEN 69 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 366,741 Number of Sequences: 2352 Number of extensions: 5794 Number of successful extensions: 32 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30356973 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -