BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31201 (390 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM083078-1|CAL07224.1| 101|Homo sapiens immunoglobulin heavy ch... 31 1.3 U27699-1|AAA87029.1| 614|Homo sapiens pephBGT-1 betaine-GABA tr... 29 5.3 L42300-1|AAA66574.1| 614|Homo sapiens betaine/GABA transporter ... 29 5.3 BC126217-1|AAI26218.1| 614|Homo sapiens solute carrier family 6... 29 5.3 BC126215-1|AAI26216.1| 614|Homo sapiens solute carrier family 6... 29 5.3 X99699-1|CAA68030.1| 317|Homo sapiens XIAP associated factor-1 ... 29 7.1 BC073156-1|AAH73156.1| 301|Homo sapiens XIAP associated factor-... 29 7.1 BC064590-1|AAH64590.1| 306|Homo sapiens Yip1 domain family, mem... 28 9.3 >AM083078-1|CAL07224.1| 101|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 101 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 56 NWERYTPFQYNRVYSTVSPFGYKPGRYVADPSRYDPSRDN 175 NW R TP + + STVS FG K + R+ SRDN Sbjct: 38 NWVRQTPGKGLQWVSTVSAFGDKEDNADSGKGRFTISRDN 77 >U27699-1|AAA87029.1| 614|Homo sapiens pephBGT-1 betaine-GABA transporter protein. Length = 614 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 65 RYTPFQYNRVYSTVSPFGYKPGRYVA 142 +YTP +YN VY P+GY G ++A Sbjct: 519 KYTPLKYNNVY-VYPPWGYSIGWFLA 543 >L42300-1|AAA66574.1| 614|Homo sapiens betaine/GABA transporter protein. Length = 614 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 65 RYTPFQYNRVYSTVSPFGYKPGRYVA 142 +YTP +YN VY P+GY G ++A Sbjct: 519 KYTPLKYNNVY-VYPPWGYSIGWFLA 543 >BC126217-1|AAI26218.1| 614|Homo sapiens solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 protein. Length = 614 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 65 RYTPFQYNRVYSTVSPFGYKPGRYVA 142 +YTP +YN VY P+GY G ++A Sbjct: 519 KYTPLKYNNVY-VYPPWGYSIGWFLA 543 >BC126215-1|AAI26216.1| 614|Homo sapiens solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 protein. Length = 614 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 65 RYTPFQYNRVYSTVSPFGYKPGRYVA 142 +YTP +YN VY P+GY G ++A Sbjct: 519 KYTPLKYNNVY-VYPPWGYSIGWFLA 543 >X99699-1|CAA68030.1| 317|Homo sapiens XIAP associated factor-1 (ZAP-1) protein. Length = 317 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 258 LDPVLLEVPEEPTSEPRQDLIKY--LGDAYKGSTIVPLPGVN 377 LDP+L+ P+ TS PR D Y L + ++PLP +N Sbjct: 239 LDPLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILN 280 >BC073156-1|AAH73156.1| 301|Homo sapiens XIAP associated factor-1 protein. Length = 301 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 258 LDPVLLEVPEEPTSEPRQDLIKY--LGDAYKGSTIVPLPGVN 377 LDP+L+ P+ TS PR D Y L + ++PLP +N Sbjct: 239 LDPLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILN 280 >BC064590-1|AAH64590.1| 306|Homo sapiens Yip1 domain family, member 1 protein. Length = 306 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 151 AWISYIAAWFIAEWRNSRVNSVV 83 AW+ +A W WRNS+V ++V Sbjct: 172 AWLVPLALWGFLMWRNSKVMNIV 194 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,705,561 Number of Sequences: 237096 Number of extensions: 861454 Number of successful extensions: 2172 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2172 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2698607930 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -