BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31201 (390 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110485-20|CAB60368.2| 600|Caenorhabditis elegans Hypothetical... 28 2.0 Z75955-2|CAB00112.1| 355|Caenorhabditis elegans Hypothetical pr... 26 8.2 >AL110485-20|CAB60368.2| 600|Caenorhabditis elegans Hypothetical protein Y46G5A.25 protein. Length = 600 Score = 28.3 bits (60), Expect = 2.0 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +2 Query: 65 RYTPFQYNRVYSTVSPFGYKPGRYVADPSR--YDPSRDNCWPLHL 193 R PF Y R+ + FG+ Y+ PS+ D + N WP+ + Sbjct: 163 RSPPFVYRRIMPALEGFGWVAANYIVKPSKGLLDINSIN-WPIFI 206 >Z75955-2|CAB00112.1| 355|Caenorhabditis elegans Hypothetical protein R07B7.3 protein. Length = 355 Score = 26.2 bits (55), Expect = 8.2 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 74 PFQYNRVYSTVSPFGYKPGRYVAD 145 P Q N V V P Y+P +YV D Sbjct: 319 PVQRNNVVRQVQPVQYRPVQYVTD 342 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,775,490 Number of Sequences: 27780 Number of extensions: 127015 Number of successful extensions: 350 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 587646290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -